KEGG   Homo sapiens (human): 64421Help
Entry
64421             CDS       T01001                                 

Gene name
DCLRE1C, A-SCID, DCLREC1C, RS-SCID, SCIDA, SNM1C
Definition
(RefSeq) DNA cross-link repair 1C
  KO
K10887  
DNA cross-link repair 1C protein [EC:3.1.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
Non-homologous end-joining
Primary immunodeficiency
Disease
H00092  
T-B-Severe combined immunodeficiencies (SCIDs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    64421 (DCLRE1C)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    64421 (DCLRE1C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     64421 (DCLRE1C)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Other NHEJ factors
     64421 (DCLRE1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q96SD1(Tbio)
UniProt: 
Position
10p13
AA seq 692 aa AA seqDB search
MSSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRLECSLKVYLY
CSPVTKELLLTSPKYRFWKKRIISIEIETPTQISLVDEASGEKEEIVVTLLPAGHCPGSV
MFLFQGNNGTVLYTGDFRLAQGEAARMELLHSGGRVKDIQSVYLDTTFCDPRFYQIPSRE
ECLSGVLELVRSWITRSPYHVVWLNCKAAYGYEYLFTNLSEELGVQVHVNKLDMFRNMPE
ILHHLTTDRNTQIHACRHPKAEEYFQWSKLPCGITSRNRIPLHIISIKPSTMWFGERSRK
TNVIVRTGESSYRACFSFHSSYSEIKDFLSYLCPVNAYPNVIPVGTTMDKVVEILKPLCR
SSQSTEPKYKPLGKLKRARTVHRDSEEEDDYLFDDPLPIPLRHKVPYPETFHPEVFSMTA
VSEKQPEKLRQTPGCCRAECMQSSRFTNFVDCEESNSESEEEVGIPASLQGDLGSVLHLQ
KADGDVPQWEVFFKRNDEITDESLENFPSSTVAGGSQSPKLFSDSDGESTHISSQNSSQS
THITEQGSQGWDSQSDTVLLSSQERNSGDITSLDKADYRPTIKENIPASLMEQNVICPKD
TYSDLKSRDKDVTIVPSTGEPTTLSSETHIPEEKSLLNLSTNADSQSSSDFEVPSTPEAE
LPKREHLQYLYEKLATGESIAVKKRKCSLLDT
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgagttctttcgaggggcagatggccgagtatccaactatctccatagaccgcttcgat
agggagaacctgagggcccgcgcctacttcctgtcccactgccacaaagatcacatgaaa
ggattaagagcccctaccttgaaaagaaggttggagtgcagcttgaaggtttatctatac
tgttcacctgtgactaaggagttgttgttaacgagcccgaaatacagattttggaagaaa
cgaattatatctattgaaatcgagactcctacccagatatctttagtggatgaagcatca
ggagagaaggaagagattgttgtgactctcttaccagctggtcactgtccgggatcagtt
atgtttttatttcagggcaataatggaactgtcctgtacacaggagacttcagattggcg
caaggagaagctgctagaatggagcttctgcactccgggggcagagtcaaagacatccaa
agtgtatatttggatactacgttctgtgatccaagattttaccaaattccaagtcgggag
gagtgtttaagtggagtcttagagctggtccgaagctggatcactcggagcccgtaccat
gttgtgtggctgaactgcaaagcggcttatggctatgaatatctgttcaccaaccttagt
gaagaattaggagtccaggttcatgtgaataagctagacatgtttaggaacatgcctgag
atccttcatcatctcacaacagaccgcaacactcagatccatgcatgccggcatcccaag
gcagaggaatattttcagtggagcaaattaccctgtggaattacttccagaaatagaatt
ccactccacataatcagcattaagccatccaccatgtggtttggagaaaggagcagaaaa
acaaatgtaattgtgaggactggagagagttcatacagagcttgtttttcttttcactcc
tcctacagtgagattaaagatttcttgagctacctctgtcctgtgaacgcatatccaaat
gtcattccagttggcacaactatggataaagttgtcgaaatcttaaagcctttatgccgg
tcttcccaaagtacggagccaaagtataaaccactgggaaaactgaagagagctagaaca
gttcaccgagactcagaggaggaagatgactatctctttgatgatcctctgccaatacct
ttaaggcacaaagttccatacccggaaacttttcaccctgaggtattttcaatgactgca
gtatcagaaaagcagcctgaaaaactgagacaaaccccaggatgctgcagagcagagtgt
atgcagagctctcgtttcacaaactttgtagattgtgaagaatccaacagtgaaagtgaa
gaagaagtaggaatcccagcttcactgcaaggagatctgggctctgtacttcacctgcaa
aaggctgatggggatgtaccccagtgggaagtattctttaaaagaaatgatgaaatcaca
gatgagagtttggaaaacttcccttcctccacagtggcagggggatctcagtcaccaaag
cttttcagtgactctgatggagaatcaactcacatctcctcccagaattcttcccagtca
acacacataacagaacaaggaagtcaaggctgggacagccaatctgatactgttttgtta
tcttcccaagagagaaacagtggggatattacttccttggacaaagctgactacagacca
acaatcaaagagaatattcctgcctctctcatggaacaaaatgtaatttgcccaaaggat
acttactctgatttgaaaagcagagataaagatgtgacaatagttcctagtactggagaa
ccaactactctaagcagtgagacacatatacccgaggaaaaaagtttgctaaatcttagc
acaaatgcagattcccagagctcttctgattttgaagttccctcaactccagaagctgag
ttacctaaacgagagcatttacaatatttatatgagaagctggcaactggtgagagtata
gcagtcaaaaaaagaaaatgctcactcttagatacctaa

DBGET integrated database retrieval system