KEGG   Homo sapiens (human): 64422Help
Entry
64422             CDS       T01001                                 

Gene name
ATG3, APG3, APG3-LIKE, APG3L, PC3-96
Definition
autophagy related 3
Orthology
K08343  
ubiquitin-like-conjugating enzyme ATG3 [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of autophagy
Class
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:hsa04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q13.2
AA seq 311 aa AA seqDB search
MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEE
LKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGIT
EAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVE
ACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDH
VKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYPSLYVRLVAKW
LLTIFFLRNLV
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatgtgattaatactgtgaagggaaaggcactggaagtggctgagtacctgacc
ccggtcctcaaggaatcaaagtttaaggaaacaggtgtaattaccccagaagagtttgtg
gcagctggagatcacctagtccaccactgtccaacatggcaatgggctacaggggaagaa
ttgaaagtgaaggcatacctaccaacaggcaaacaatttttggtaaccaaaaatgtgccg
tgctataagcggtgcaaacagatggaatattcagatgaattggaagctatcattgaagaa
gatgatggtgatggcggatgggtagatacatatcacaacacaggtattacaggaataacg
gaagccgttaaagagatcacactggaaaataaggacaatataaggcttcaagattgctca
gcactatgtgaagaggaagaagatgaagatgaaggagaagctgcagatatggaagaatat
gaagagagtggattgttggaaacagatgaggctaccctagatacaaggaaaatagtagaa
gcttgtaaagccaaaactgatgctggcggtgaagatgctattttgcaaaccagaacttat
gacctttacatcacttatgataaatattaccagactccacgattatggttgtttggctat
gatgagcaacggcagcctttaacagttgagcacatgtatgaagacatcagtcaggatcat
gtgaagaaaacagtgaccattgaaaatcaccctcatctgccaccacctcccatgtgttca
gttcacccatgcaggcatgctgaggtgatgaagaaaatcattgagactgttgcagaagga
gggggagaacttggagttcatatgtatccttccctgtatgtaagattagtggcaaaatgg
ctgttaacgattttttttttgagaaatttagtgtaa

DBGET integrated database retrieval system