KEGG   Homo sapiens (human): 6443Help
Entry
6443              CDS       T01001                                 

Gene name
SGCB, A3b, LGMD2E, SGC
Definition
sarcoglycan, beta (43kDa dystrophin-associated glycoprotein)
Orthology
K12566  
beta-sarcoglycan
Organism
hsa  Homo sapiens (human)
Pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Viral myocarditis
Disease
H00565  
Sarcoglycanopathies
H00593  
Limb-girdle muscular dystrophy (LGMD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    6443 (SGCB)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    6443 (SGCB)
   05414 Dilated cardiomyopathy (DCM)
    6443 (SGCB)
   05416 Viral myocarditis
    6443 (SGCB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q12
AA seq 318 aa AA seqDB search
MAAAAAAAAEQQSSNGPVKKSMREKAVERRSVNKEHNSNFKAGYIPIDEDRLHKTGLRGR
KGNLAICVIILLFILAVINLIITLVIWAVIRIGPNGCDSMEFHESGLLRFKQVSDMGVIH
PLYKSTVGGRRNENLVITGNNQPIVFQQGTTKLSVENNKTSITSDIGMQFFDPRTQNILF
STDYETHEFHLPSGVKSLNVQKASTERITSNATSDLNIKVDGRAIVRGNEGVFIMGKTIE
FHMGGNMELKAENSIILNGSVMVSTTRLPSSSSGDQLGSGDWVRYKLCMCADGTLFKVQV
TSQNMGCQISDNPCGNTH
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagcggcggcggcggctgcagaacagcaaagttccaatggtcctgtaaagaag
tccatgcgtgagaaggctgttgagagaaggagtgtcaataaagagcacaacagtaacttt
aaagctggatacattccgattgatgaagatcgtctccacaaaacagggttgagaggaaga
aagggcaatttagccatctgtgtgattatcctcttgtttatcctggctgtcatcaattta
ataataacacttgttatttgggccgtgattcgcattggaccaaatggctgtgatagtatg
gagtttcatgaaagtggcctgcttcgatttaagcaagtatctgacatgggagtgatccac
cctctttataaaagcacagtaggaggaaggcgaaatgaaaatttggtcatcactggcaac
aaccagcctattgtttttcagcaagggacaacaaagctcagtgtagaaaacaacaaaact
tctattacaagtgacatcggcatgcagttttttgacccgaggactcaaaatatcttattc
agcacagactatgaaactcatgagtttcatttgccaagtggagtgaaaagtttgaatgtt
caaaaggcatctactgaaaggattaccagcaatgctaccagtgatttaaatataaaagtt
gatgggcgtgctattgtgcgtggaaatgaaggtgtattcattatgggcaaaaccattgaa
tttcacatgggtggtaatatggagttaaaggcggaaaacagtatcatcctaaatggatct
gtgatggtcagcaccacccgcctacccagttcctccagtggagaccagttgggtagtggt
gactgggtacgctacaagctctgcatgtgtgctgatgggacgctcttcaaggtgcaagta
accagccagaacatgggctgccaaatctcagacaacccctgtggaaacactcattaa

DBGET integrated database retrieval system