KEGG   Homo sapiens (human): 6446Help
Entry
6446              CDS       T01001                                 

Gene name
SGK1, SGK
Definition
serum/glucocorticoid regulated kinase 1 (EC:2.7.11.1)
Orthology
K13302  
serum/glucocorticoid-regulated kinase 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
PI3K-Akt signaling pathway
Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    6446 (SGK1)
   04151 PI3K-Akt signaling pathway
    6446 (SGK1)
 Organismal Systems
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    6446 (SGK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6446 (SGK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  SGK family [OT]
   6446 (SGK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q23
AA seq 526 aa AA seqDB search
MVNKDMNGFPVKKCSAFQFFKKRVRRWIKSPMVSVDKHQSPSLKYTGSSMVHIPPGEPDF
ESSLCQTCLGEHAFQRGVLPQENESCSWETQSGCEVREPCNHANILTKPDPRTFWTNDDP
AFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINL
GPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIMS
ERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAE
IASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLA
PEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSAR
HLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHF
DPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLGFSYAPPTDSFL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacaaagacatgaatggattcccagtcaagaaatgctcagccttccaatttttt
aagaagcgggtacgaaggtggatcaagagcccaatggtcagtgtggacaagcatcagagt
cccagcctgaagtacaccggctcctccatggtgcacatccctccaggggagccagacttc
gagtcttccttgtgtcaaacatgcctgggtgaacatgctttccaaagaggggttctccct
caggagaacgagtcatgttcatgggaaactcaatctgggtgtgaagtgagagagccatgt
aatcatgccaacatcctgaccaagcccgatccaagaaccttctggactaatgatgatcca
gctttcatgaagcagaggaggatgggtctgaacgactttattcagaagattgccaataac
tcctatgcatgcaaacaccctgaagttcagtccatcttgaagatctcccaacctcaggag
cctgagcttatgaatgccaacccttctcctccaccaagtccttctcagcaaatcaacctt
ggcccgtcgtccaatcctcatgctaaaccatctgactttcacttcttgaaagtgatcgga
aagggcagttttggaaaggttcttctagcaagacacaaggcagaagaagtgttctatgca
gtcaaagttttacagaagaaagcaatcctgaaaaagaaagaggagaagcatattatgtcg
gagcggaatgttctgttgaagaatgtgaagcaccctttcctggtgggccttcacttctct
ttccagactgctgacaaattgtactttgtcctagactacattaatggtggagagttgttc
taccatctccagagggaacgctgcttcctggaaccacgggctcgtttctatgctgctgaa
atagccagtgccttgggctacctgcattcactgaacatcgtttatagagacttaaaacca
gagaatattttgctagattcacagggacacattgtccttactgacttcggactctgcaag
gagaacattgaacacaacagcacaacatccaccttctgtggcacgccggagtatctcgca
cctgaggtgcttcataagcagccttatgacaggactgtggactggtggtgcctgggagct
gtcttgtatgagatgctgtatggcctgccgcctttttatagccgaaacacagctgaaatg
tacgacaacattctgaacaagcctctccagctgaaaccaaatattacaaattccgcaaga
cacctcctggagggcctcctgcagaaggacaggacaaagcggctcggggccaaggatgac
ttcatggagattaagagtcatgtcttcttctccttaattaactgggatgatctcattaat
aagaagattactcccccttttaacccaaatgtgagtgggcccaacgacctacggcacttt
gaccccgagtttaccgaagagcctgtccccaactccattggcaagtcccctgacagcgtc
ctcgtcacagccagcgtcaaggaagctgccgaggctttcctaggcttttcctatgcgcct
cccacggactctttcctctga

DBGET integrated database retrieval system