KEGG   Homo sapiens (human): 6447Help
Entry
6447              CDS       T01001                                 

Gene name
SCG5, 7B2, P7B2, SGNE1, SgV
Definition
(RefSeq) secretogranin V
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Secretogranin_V TAtT
Motif
Other DBs
NCBI-GeneID: 6447
NCBI-ProteinID: NP_001138229
OMIM: 173120
HGNC: 10816
Ensembl: ENSG00000166922
Vega: OTTHUMG00000159447
Pharos: P05408(Tbio)
UniProt: P05408 A0A024R9I1
Position
15q13.3
AA seq 212 aa AA seqDB search
MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEY
PAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPC
PVGKTADDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKR
RSVNPYLQGQRLDNVVAKKSVPHFSDEDKDPE
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggtctccaggatggtctctaccatgctatctggcctactgttttggctggcatctgga
tggactccagcatttgcttacagcccccggacccctgaccgggtctcagaagcagatatc
cagaggctgcttcatggtgttatggagcaattgggcattgccaggccccgagtggaatat
ccagctcaccaggccatgaatcttgtgggcccccagagcattgaaggtggagctcatgaa
ggacttcagcatttgggtccttttggcaacatccccaacatcgtggcagagttgactgga
gacaacattcctaaggactttagtgaggatcaggggtacccagaccctccaaatccctgt
cctgttggaaaaacagcagatgatggatgtctagaaaacacccctgacactgcagagttc
agtcgagagttccagttgcaccagcatctctttgatccggaacatgactatccaggcttg
ggcaagtggaacaagaaactcctttacgagaagatgaagggaggagagagacgaaagcgg
aggagtgtcaatccatatctacaaggacagagactggataatgttgttgcaaagaagtct
gtcccccatttttcagatgaggataaggatccagagtaa

DBGET integrated database retrieval system