KEGG   Homo sapiens (human): 6447Help
Entry
6447              CDS       T01001                                 

Gene name
SCG5, 7B2, P7B2, SGNE1, SgV
Definition
(RefSeq) secretogranin V
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q13-q14
AA seq 212 aa AA seqDB search
MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEY
PAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPC
PVGKTADDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKR
RSVNPYLQGQRLDNVVAKKSVPHFSDEDKDPE
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggtctccaggatggtctctaccatgctatctggcctactgttttggctggcatctgga
tggactccagcatttgcttacagcccccggacccctgaccgggtctcagaagcagatatc
cagaggctgcttcatggtgttatggagcaattgggcattgccaggccccgagtggaatat
ccagctcaccaggccatgaatcttgtgggcccccagagcattgaaggtggagctcatgaa
ggacttcagcatttgggtccttttggcaacatccccaacatcgtggcagagttgactgga
gacaacattcctaaggactttagtgaggatcaggggtacccagaccctccaaatccctgt
cctgttggaaaaacagcagatgatggatgtctagaaaacacccctgacactgcagagttc
agtcgagagttccagttgcaccagcatctctttgatccggaacatgactatccaggcttg
ggcaagtggaacaagaaactcctttacgagaagatgaagggaggagagagacgaaagcgg
aggagtgtcaatccatatctacaaggacagagactggataatgttgttgcaaagaagtct
gtcccccatttttcagatgaggataaggatccagagtaa

DBGET integrated database retrieval system