KEGG   Homo sapiens (human): 64506Help
Entry
64506             CDS       T01001                                 

Gene name
CPEB1, CEBP, CPE-BP1, CPEB, CPEB-1, hCPEB-1
Definition
cytoplasmic polyadenylation element binding protein 1
Orthology
K02602  
oo18 RNA-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
Oocyte meiosis
Dorso-ventral axis formation
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    64506 (CPEB1)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    64506 (CPEB1)
  Development
   04320 Dorso-ventral axis formation
    64506 (CPEB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q25.2
AA seq 491 aa AA seqDB search
MLFPTSAQESSRGLPDANDLCLGLQSLSLTGWDRPWSTQDSDSSAQSSTHSVLSMLHNPL
GNVLGKPPLSFLPLDPLGSDLVDKFPAPSVRGSRLDTRPILDSRSSSPSDSDTSGFSSGS
DHLSDLISSLRISPPLPFLSLSGGGPRDPLKMGVGSRMDQEQAALAAVTPSPTSASKRWP
GASVWPSWDLLEAPKDPFSIEREARLHRQAAAVNEATCTWSGQLPPRNYKNPIYSCKVFL
GGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGNMPKGYVYLVFELEKSVRSL
LQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSRTVFVG
ALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEI
KTTKFTKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWHWRHSMEGLRHHSP
LMRNQKNRDSS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgcttttcccaacctctgcgcaagaatcttcccgtggcctcccagatgcaaatgacttg
tgccttggcctgcagtccctcagtctgacaggctgggaccgaccctggagcacccaggac
tcagattcctcagcccagagcagcacacactcggtactgagcatgctccataacccactg
ggaaatgtcctaggaaaaccccccttgagcttcctgcctctggatccccttgggtctgac
ttggtggacaagtttccagcaccctcagttagaggatcacgcctggacacccggcccatc
ctggactctcgatctagcagcccctctgactcagacaccagtggcttcagctctggatca
gatcatctctcagatttgatttcaagccttcgcatttctccacctctgcccttcctgtct
ctgtcagggggtggtcccagagaccctttaaagatgggggtagggtctcggatggaccaa
gagcaagctgctcttgctgcagtcactccctccccaaccagtgcttcaaagagatggcca
ggagcttctgtgtggccatcctgggacctcctcgaagctcccaaagaccccttcagcata
gagagagaggccaggctgcaccgacaagctgcagctgtgaatgaagccacctgtacctgg
agtggccagcttcctccccggaactataagaaccccatctactcttgcaaggtgtttcta
ggaggtgttccttgggatattacagaagctggattagttaacaccttccgtgtttttggc
tctttgagtgtggagtggcctggtaaggatggcaagcatccccggtgtcctcccaaaggt
aatatgcctaaagggtatgtgtatctggtcttcgaactagagaagtctgtccgatccttg
cttcaggcttgctctcatgacccgctgagcccagatggcctgagtgaatattatttcaag
atgtccagccgaaggatgcgctgcaaggaggtgcaggtgatcccctgggtattagccgac
agtaactttgtccggagcccatctcagaggcttgaccccagcaggacggtgtttgtcggt
gctctgcatggaatgctaaatgctgaggccctggcagccatcttgaacgacctatttggt
ggagtggtgtatgccgggattgacacagataagcacaagtatcccattggttctggtcgt
gtgactttcaataaccaacggagttacctgaaagcagtcagcgctgcttttgtggagatc
aaaaccaccaagttcacaaagaaggttcagattgacccctacctagaagattctctgtgt
catatctgcagttctcagcctggtcctttcttctgtcgagatcaggtctgcttcaaatac
ttctgccggagctgctggcactggcggcacagcatggagggcctgcgccaccacagcccc
ctgatgcggaaccagaagaaccgagattccagctag

DBGET integrated database retrieval system