KEGG   Homo sapiens (human): 6456Help
Entry
6456              CDS       T01001                                 

Gene name
SH3GL2, CNSA2, EEN-B1, SH3D2A, SH3P4
Definition
(RefSeq) SH3 domain containing GRB2 like 2, endophilin A1
  KO
K11247  
endophilin-A
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    6456 (SH3GL2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    6456 (SH3GL2)
  Bin/Amphiphysin/Rvs (BAR) family proteins
   N-BAR proteins
    6456 (SH3GL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q99962(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
9p22.2
AA seq 352 aa AA seqDB search
MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQP
NPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA
MRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPD
EELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRL
EERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD
FEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVALPH
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtggccggcctcaagaagcagttccataaagccactcagaaagtgagtgagaag
gttggaggagctgaaggaaccaagctagatgatgacttcaaagagatggaaaggaaagtg
gatgtcaccagcagggctgtgatggaaataatgactaaaacaattgaataccttcaaccc
aatccagcttccagagctaagctcagcatgatcaacaccatgtcaaaaatccgtggccag
gagaaggggccaggctatcctcaggcagaggcgctgctggcagaggccatgctcaaattt
ggaagagagcttggagatgattgcaactttggcccagcacttggtgaggtcggggaggcc
atgcgggaactgtcggaggtcaaagactctttggacatagaagtgaagcagaacttcatt
gaccctcttcagaatcttcatgacaaagatcttagggaaattcaacatcatctaaagaag
ttggagggtcgacgcctggattttgattataagaagaaacgacaaggcaagattccggat
gaagagcttcgtcaagctctagagaaatttgatgagtctaaggaaattgctgagtcaagc
atgttcaatctcttggagatggatattgaacaagtgagccagctctctgcacttgtgcaa
gctcagctggagtaccacaagcaggcagtccagatcctgcagcaagtcacggtcagactg
gaagaaagaataagacaggcttcatctcagcctagaagggaatatcaacctaaaccacga
atgagcctggagtttccaactggagacagtactcagcccaatgggggtctctcccacaca
ggcactcccaaaccttcaggtgtccaaatggatcagccctgctgccgagctctgtacgac
tttgaacctgaaaatgaaggggagttgggatttaaagagggcgatatcatcacactcact
aaccaaattgatgagaactggtatgaggggatgctgcatggccattcaggcttcttcccc
atcaattatgtggaaattctggttgccctgccccattag

DBGET integrated database retrieval system