KEGG   Homo sapiens (human): 6457Help
Entry
6457              CDS       T01001                                 

Gene name
SH3GL3, CNSA3, EEN-B2, HsT19371, SH3D2C, SH3P13
Definition
SH3-domain GRB2-like 3
Orthology
K11247  
endophilin-A
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    6457 (SH3GL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q24
AA seq 278 aa AA seqDB search
MLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKD
SLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEK
FEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASS
VPRREYKPRPVKRSSSELNGVSTTSVVKTTGSNIPMDQPCCRGLYDFEPENQGELGFKEG
DIITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacactgtgtcgaagatccgagggcaggtgaagaccacaggatacccgcagacg
gaaggcttgctgggggactgtatgctgaaatacgggaaggagctcggggaagactccacc
tttggcaatgcattgatagaagttggtgaatccatgaagctaatggctgaggtgaaagac
tctcttgatattaatgtaaagcaaacttttattgatccacttcagttactacaagataaa
gatttaaaagagatcgggcatcacctgaaaaagctggaaggccgccgcctggattacgat
tataaaaagaaacgagtaggtaagataccagacgaagaagtcagacaagcggtagaaaaa
tttgaagagtcaaaggagttggctgaaagaagcatgtttaactttttagaaaatgatgta
gaacaagtcagccagttggctgtgttcatagaggcagcattagactatcacagacagtcc
acagagattctgcaggagctgcagagcaagctacagatgcgaatatcagctgcatccagt
gtccccagacgagaatacaagccaaggcctgtgaaaaggagttctagtgagctcaatgga
gtttccaccacctctgtagtgaagacgacaggttctaacattcccatggaccagccctgc
tgtcgtggtctctatgactttgagccagaaaaccaaggagaattaggatttaaagaaggg
gacatcattacattaaccaatcaaatagatgaaaactggtatgaaggaatgatacacgga
gaatcgggattcttccccattaattacgtggaagtgatcgtgcctttacctcagtaa

DBGET integrated database retrieval system