KEGG   Homo sapiens (human): 6457Help
Entry
6457              CDS       T01001                                 

Gene name
SH3GL3, CNSA3, EEN-B2, HsT19371, SH3D2C, SH3P13
Definition
(RefSeq) SH3 domain containing GRB2 like 3, endophilin A3
  KO
K11247  endophilin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    6457 (SH3GL3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    6457 (SH3GL3)
  Bin/Amphiphysin/Rvs (BAR) family proteins
   N-BAR proteins
    6457 (SH3GL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAR SH3_2 SH3_1 SH3_9 BAR_2 BAR_3 DUF824
Motif
Other DBs
NCBI-GeneID: 6457
NCBI-ProteinID: NP_003018
OMIM: 603362
HGNC: 10832
Ensembl: ENSG00000140600
Vega: OTTHUMG00000147361
Pharos: Q99963(Tbio)
UniProt: Q99963
Structure
PDB: 

Jmol
Position
15q25.2
AA seq 347 aa AA seqDB search
MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQP
NPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGES
MKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPD
EEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKL
QMRISAASSVPRREYKPRPVKRSSSELNGVSTTSVVKTTGSNIPMDQPCCRGLYDFEPEN
QGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtggccgggctgaagaagcagttccacaaagccagccagctatttagtgaaaaa
ataagtggtgctgaaggaactaaactagacgatgaatttcttgacatggaaaggaaaata
gatgttaccaataaagttgttgcagaaattctttcaaaaaccactgaatatcttcagcca
aatccagcatacagagctaagctaggaatgctgaacactgtgtcgaagatccgagggcag
gtgaagaccacaggatacccgcagacggaaggcttgctgggggactgtatgctgaaatac
gggaaggagctcggggaagactccacctttggcaatgcattgatagaagttggtgaatcc
atgaagctaatggctgaggtgaaagactctcttgatattaatgtaaagcaaacttttatt
gatccacttcagttactacaagataaagatttaaaagagatcgggcatcacctgaaaaag
ctggaaggccgccgcctggattacgattataaaaagaaacgagtaggtaagataccagac
gaagaagtcagacaagcggtagaaaaatttgaagagtcaaaggagttggctgaaagaagc
atgtttaactttttagaaaatgatgtagaacaagtcagccagttggctgtgttcatagag
gcagcattagactatcacagacagtccacagagattctgcaggagctgcagagcaagcta
cagatgcgaatatcagctgcatccagtgtccccagacgagaatacaagccaaggcctgtg
aaaaggagttctagtgagctcaatggagtttccaccacctctgtagtgaagacgacaggt
tctaacattcccatggaccagccctgctgtcgtggtctctatgactttgagccagaaaac
caaggagaattaggatttaaagaaggggacatcattacattaaccaatcaaatagatgaa
aactggtatgaaggaatgatacacggagaatcgggattcttccccattaattacgtggaa
gtgatcgtgcctttacctcagtaa

DBGET integrated database retrieval system