KEGG   Homo sapiens (human): 64582Help
Entry
64582             CDS       T01001                                 

Gene name
GPR135, HUMNPIIY20
Definition
(RefSeq) G protein-coupled receptor 135
  KO
K08427  
G protein-coupled receptor 135
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Other
   Putative / unclassified Class A GPCRs
    64582 (GPR135)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q23.1
AA seq 494 aa AA seqDB search
MEEPQPPRPPASMALLGSQHSGAPSAAGPPGGTSSAATAAVLSFSTVATAALGNLSDASG
GGTAAAPGGGGLGGSGAAREAGAAVRRPLGPEAAPLLSHGAAVAAQALVLLLIFLLSSLG
NCAVMGVIVKHRQLRTVTNAFILSLSLSDLLTALLCLPAAFLDLFTPPGGSAPAAAAGPW
RGFCAASRFFSSCFGIVSTLSVALISLDRYCAIVRPPREKIGRRRALQLLAGAWLTALGF
SLPWELLGAPRELAAAQSFHGCLYRTSPDPAQLGAAFSVGLVVACYLLPFLLMCFCHYHI
CKTVRLSDVRVRPVNTYARVLRFFSEVRTATTVLIMIVFVICCWGPYCFLVLLAAARQAQ
TMQAPSLLSVVAVWLTWANGAINPVIYAIRNPNISMLLGRNREEGYRTRNVDAFLPSQGP
GLQARSRSRLRNRYANRLGACNRMSSSNPASGVAGDVAMWARKNPVVLFCREGPPEPVTA
VTKQPKSEAGDTSL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggaggagccgcagccgccccgcccaccagcgagcatggccttactgggcagccagcac
tccggcgccccctccgcggccggcccacctggcgggacttcctccgcggccacggcggcc
gtgctctccttcagcaccgtggcgaccgcggcgctggggaacctgagcgacgcaagcgga
ggcggcacagctgccgctcccggtggcggcggccttggcgggtccggggcagcgcgggag
gcgggggcggcggtgaggcggccgctaggcccggaggcggcgccgctgctgtcgcacgga
gctgcagtggcggcccaggcgctcgtcctcctgctcatcttcctgctgtctagccttggc
aactgcgcggtgatgggggtgattgtgaagcaccggcagctccgcaccgtcaccaacgcc
ttcatcctgtcgctgtccctatcggatctgctcacggcgctgctctgcctgcccgccgcc
ttcctggacctcttcactccgcccgggggttcggcgcctgccgccgccgcggggccctgg
cgcggcttctgcgccgccagccgcttcttcagctcgtgcttcggcatcgtgtccacgctc
agcgtggcgctcatctcgttggaccgttactgcgctatcgtgcggccgccgcgggagaag
atcggccgccgccgcgcgctgcagctgctggcgggcgcctggctgacggccctgggcttc
tccttgccctgggagctgctcggggcgccccgggaactcgcggcggcgcagagcttccac
ggctgcctctaccggacctccccggaccccgcgcagctgggcgcggccttcagcgtgggg
ctggtggtggcctgctacctgctgcccttcctgctcatgtgcttctgccactaccacatc
tgcaagacggtgcgcctgtcggacgtgcgcgtgcggccggtgaacacctacgcgcgcgtg
ctgcgcttcttcagcgaggtgcgcacggccaccaccgtcctcatcatgatcgtcttcgtc
atctgctgctgggggccctactgcttcctggtgctgctggccgccgcccggcaggcccag
accatgcaggccccctcgctcctcagcgtggtggccgtctggctgacctgggccaatggg
gccatcaaccctgtcatctacgccatccgcaatcccaacatttcgatgctcctagggcgc
aaccgcgaggagggctaccggactaggaatgtggacgctttcctgcccagccagggcccg
ggtctgcaagccagaagccgcagtcgccttcgaaaccgctatgccaaccggctgggggcc
tgcaacaggatgtcctcttccaacccggccagcggagtggcaggggacgtggccatgtgg
gcccgcaaaaatccagttgtacttttctgccgagagggaccaccagagccggtgacggca
gtgaccaaacagcctaaatccgaagctggggataccagcctctaa

DBGET integrated database retrieval system