KEGG   Homo sapiens (human): 6462Help
Entry
6462              CDS       T01001                                 

Gene name
SHBG, ABP, SBP, TEBG
Definition
(RefSeq) sex hormone binding globulin
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p13.1
AA seq 402 aa AA seqDB search
MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMT
FDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGA
GPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPAS
NLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDI
PQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPL
VLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTS
FCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggagagcagaggcccactggctacctcgcgcctgctgctgttgctgctgttgctacta
ctgcgtcacacccgccagggatgggccctgagacctgttctccccacccagagtgcccac
gaccctccggctgtccacctcagcaatggcccaggacaagagcctatcgctgtcatgacc
tttgacctcaccaagatcacaaaaacctcctcctcctttgaggttcgaacctgggaccca
gagggagtgattttttatggggataccaaccctaaggatgactggtttatgctgggactt
cgagacggcaggcctgagatccaactgcacaatcactgggcccagcttacggtgggtgct
ggaccacggctggatgatgggagatggcaccaggtggaagtcaagatggagggggactct
gtgctgctggaggtggatggggaggaggtgctgcgcctgagacaggtctctgggcccctg
accagcaaacgccatcccatcatgaggattgcgcttggggggctgctcttccccgcttcc
aaccttcggttgccgctggttcctgccctggatggctgcctgcgccgggattcctggctg
gacaaacaggccgagatctcagcatctgcccccactagcctcagaagctgtgatgtagaa
tcaaatcccgggatatttctccctccagggactcaggcagaattcaatctccgagacatt
ccccagcctcatgcagagccctgggccttctctttggacctgggactcaagcaggcagca
ggctcaggccacctccttgctcttgggacaccagagaacccatcttggctcagtctccac
ctccaagatcaaaaggtggtgttgtcttctgggtcggggccagggctggatctgcccctg
gtcttgggactccctcttcagctgaagctgagtatgtccagggtggtcttgagccaaggg
tcgaagatgaaggcccttgccctgcctcccttaggcctggctcccctccttaacctctgg
gccaagcctcaagggcgtctcttcctgggggctttaccaggagaagactcttccacctct
ttttgcctgaatggcctttgggcacaaggtcagaggctggatgtggaccaggccctgaac
agaagccatgagatctggactcacagctgcccccagagcccaggcaatggcactgacgct
tcccattaa

DBGET integrated database retrieval system