KEGG   Homo sapiens (human): 64682Help
Entry
64682             CDS       T01001                                 

Gene name
ANAPC1, APC1, MCPR, TSG24
Definition
anaphase promoting complex subunit 1
Orthology
K03348  
anaphase-promoting complex subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    64682 (ANAPC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    64682 (ANAPC1)
   04114 Oocyte meiosis
    64682 (ANAPC1)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    64682 (ANAPC1)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    64682 (ANAPC1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     64682 (ANAPC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q12.1
AA seq 1944 aa AA seqDB search
MSNFYEERTTMIAARDLQEFVPFGRDHCKHHPNALNLQLRQLQPASELWSSDGAAGLVGS
LQEVTIHEKQKESWQLRKGVSEIGEDVDYDEELYVAGNMVIWSKGSKSQALAVYKAFTVD
SPVQQALWCDFIISQDKSEKAYSSNEVEKCICILQSSCINMHSIEGKDYIASLPFQVANV
WPTKYGLLFERSASSHEVPPGSPREPLPTMFSMLHPLDEITPLVCKSGSLFGSSRVQYVV
DHAMKIVFLNTDPSIVMTYDAVQNVHSVWTLRRVKSEEENVVLKFSEQGGTPQNVATSSS
LTAHLRSLSKGDSPVTSPFQNYSSIHSQSRSTSSPSLHSRSPSISNMAALSRAHSPALGV
HSFSGVQRFNISSHNQSPKRHSISHSPNSNSNGSFLAPETEPIVPELCIDHLWTETITNI
REKNSQASKVFITSDLCGQKFLCFLVESQLQLRCVKFQESNDKTQLIFGSVTNIPAKDAA
PVEKIDTMLVLEGSGNLVLYTGVVRVGKVFIPGLPAPSLTMSNTMPRPSTPLDGVSTPKP
LSKLLGSLDEVVLLSPVPELRDSSKLHDSLYNEDCTFQQLGTYIHSIRDPVHNRVTLELS
NGSMVRITIPEIATSELVQTCLQAIKFILPKEIAVQMLVKWYNVHSAPGGPSYHSEWNLF
VTCLMNMMGYNTDRLAWTRNFDFEGSLSPVIAPKKARPSETGSDDDWEYLLNSDYHQNVE
SHLLNRSLCLSPSEASQMKDEDFSQNLSLDSSTLLFTHIPAIFFVLHLVYEELKLNTLMG
EGICSLVELLVQLARDLKLGPYVDHYYRDYPTLVRTTGQVCTIDPGQTGFMHHPSFFTSE
PPSIYQWVSSCLKGEGMPPYPYLPGICERSRLVVLSIALYILGDESLVSDESSQYLTRIT
IAPQKLQVEQEENRFSFRHSTSVSSLAERLVVWMTNVGFTLRDLETLPFGIALPIRDAIY
HCREQPASDWPEAVCLLIGRQDLSKQACEGNLPKGKSVLSSDVPSGTETEEEDDGMNDMN
HEVMSLIWSEDLRVQDVRRLLQSAHPVRVNVVQYPELSDHEFIEEKENRLLQLCQRTMAL
PVGRGMFTLFSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMTSWASFHNG
VAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKG
HEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELDVPHNVQVAAVVGIGLV
YQGTAHRHTAEVLLAEIGRPPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLN
VPEQLYQYMVGGHRRFQTGMHREKHKSPSYQIKEGDTINVDVTCPGATLALAMIYLKTNN
RSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSIS
LSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLS
APNASVTGPHNLETCLSVVLLSLAMVMAGSGNLKVLQLCRFLHMKTGGEMNYGFHLAHHM
ALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLLV
PVDVDTNTPCYALLEVTYKGTQWYEQTKEELMAPTLLPELHLLKQIKVKGPRYWELLIDL
SKGTQHLKSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISA
FTSDPALLSFAEYFCKPTVNMGQKQEILDLFSSVLYECVTQETPEMLPAYIAMDQAIRRL
GRREMSETSELWQIKLVLEFFSSRSHQERLQNHPKRGLFMNSEFLPVVKCTIDNTLDQWL
QVGGDMCVHAYLSGQPLEESQLSMLACFLVYHSVPAPQHLPPIGLEGSTSFAELLFKFKQ
LKMPVRALLRLAPLLLGNPQPMVM
NT seq 5835 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacttctatgaagaaaggacaacgatgattgcagcaagggatttgcaggaattt
gttccttttggtcgagaccactgcaagcaccaccctaatgctttgaaccttcaacttcgc
cagctgcagccagcttctgaattatggtcttctgatggtgctgctggcttggtgggatcc
cttcaggaggttacaatccacgagaaacagaaggaaagctggcagttaaggaaaggagta
agtgaaattggagaagatgtggactatgatgaggaactctatgttgctggaaatatggtg
atatggagcaaaggaagtaaaagccaggcattggcagtttataaagcatttacagttgac
agtcctgttcagcaggcattgtggtgtgacttcattatatcacaggataagtctgaaaag
gcctacagtagcaatgaagtagaaaaatgcatatgtatattgcaaagctcatgtattaac
atgcatagcatagaaggaaaggattacatagcttcattaccatttcaggttgcaaatgtt
tggcccactaaatatggattgctgtttgaacgaagcgcttcttcacatgaagtacctcca
ggttcacccagagaacctttacctactatgttcagcatgctgcacccactagatgaaata
actccacttgtttgtaaatctggaagtctttttggttcatcacgggtgcaatatgttgta
gatcatgcaatgaaaattgttttcctcaatactgacccctctattgtaatgacttatgat
gctgttcaaaatgtgcattctgtgtggactctccggagagtcaaatcagaggaagagaat
gttgttttaaagttctctgaacaggggggaaccccacagaatgtggccactagcagctcc
ctcacagcacatctcagaagcctctccaaaggagattcccctgtgacttcacctttccag
aattactcctccattcacagccagagtcgctcaacctcatcacccagtctacattctcgc
tcaccttctatttccaacatggcagctctaagtcgtgctcattctcctgcgttaggagtg
cactctttttcaggggtgcaaaggttcaacatttcaagccataatcagtctccaaagaga
catagtatttctcattctccaaatagtaattctaatggctcctttcttgcaccagaaacg
gagccaattgttcctgaactgtgtattgaccatttgtggacagaaacgattactaatata
agagagaaaaattcacaagcctcaaaagtgtttattacatctgacctatgtgggcaaaag
ttcctgtgctttttagtagagtcccagctccagttacgctgtgtaaagtttcaagagagt
aatgataaaacccagctcatctttggttcagtgaccaacataccagcaaaggatgcagca
ccagtggagaaaatagacaccatgctggtcttggaaggcagtggaaacctggtgctatac
acaggagtggttcgggtgggaaaggtttttattcctggactgccagctccctctctgacg
atgtccaacacaatgcctcggcccagtactccactagatggcgttagtactccaaagcct
cttagtaaactccttggatcattggacgaggttgttctgttgtccccagttccagaactg
agggattcttcaaaacttcatgattctctctataatgaggattgtactttccaacagctt
ggaacttacattcattctatcagagatcctgtccataacagagtcaccctggaactgagt
aatggctccatggttaggatcactattcctgaaattgccacctctgagttagtacaaacg
tgtttgcaagcaattaagtttatcctgccaaaagaaatagcagttcagatgcttgtcaag
tggtacaatgtccacagtgctccaggaggacccagttatcactcagagtggaatttattt
gtgacttgtctcatgaacatgatgggttataacacagaccgcttagcatggactagaaat
tttgactttgaaggatcactttctcctgtcattgcgcccaaaaaagcaaggccttccgag
actggatctgatgatgactgggaatatttactaaattcagactaccaccagaatgttgag
tctcatcttttgaacagatctttatgtctgagtccttcagaagcttcacagatgaaggat
gaggatttttcacagaatctcagtctggattcttctacacttctctttactcacatacct
gcaatttttttcgttcttcaccttgtgtatgaggagcttaagttgaatactctaatggga
gaaggaatttgttcacttgttgaacttctcgttcagttggcaagggacttaaaattgggg
ccttatgtagatcattactatagagactacccaacgcttgtcagaactactggacaagtg
tgcacaattgatccaggtcaaacaggatttatgcatcatccatcattttttacgtctgag
ccaccaagtatttatcagtgggtgagttcttgtctgaagggtgaaggaatgccaccttat
ccttacctccctggaatctgtgaaagaagcagacttgtagtcttgagtattgcactgtac
atacttggtgatgagagcttggtttctgatgaatcctcacagtatttaaccagaataact
atagccccccagaagttgcaagtagaacaagaggaaaacaggtttagtttcaggcattct
acatctgtttctagtctagctgaaagattggttgtctggatgactaatgtaggattcact
ttaagagatttggaaactcttccctttggaattgctcttcccatcagagatgcaatttat
cactgtcgtgagcagcctgcctcagactggccagaagctgtctgtctcttgattggacgt
caggatctttccaagcaggcctgcgaaggaaacttacccaaagggaagtctgtgctctca
tcagatgttccttcaggaacagaaactgaggaggaagatgacggcatgaatgacatgaat
cacgaggtcatgtcattaatatggagtgaagatttaagggtgcaggatgtgcgaaggctt
cttcagagtgcgcatcctgtccgtgtcaacgtagtgcagtacccagagctcagtgaccac
gagttcatcgaggaaaaggaaaacagattgctccaattgtgtcagcgaactatggctctt
cctgtaggacgaggaatgtttaccttgttttcgtaccatcctgttccaacagagccattg
cctattcctaaattgaatctgactgggcgtgcccctcctcggaacacaacagtagacctt
aatagtggaaacatcgatgtgcctcccaacatgacaagctgggccagctttcataatggt
gtggctgctggcctgaagatagctcctgcctcccagatcgactcagcttggattgtttac
aataagcccaagcatgctgagttggccaatgagtatgctggctttctcatggctctgggt
ttgaatgggcaccttaccaagctggcgactctcaatatccatgactacttgaccaagggc
catgaaatgacaagcattggactgctacttggtgtttctgctgcaaaactaggcaccatg
gatatgtctattactcggcttcttagcattcacattcctgctctcttacccccaacgtcc
acagagctggatgttcctcacaatgtccaagtggctgcagtggttggcattggccttgta
tatcaagggacagctcacagacatactgcagaagtcctgttggctgagataggacggcct
cctggtcctgaaatggaatactgcactgacagagagtcatactccttagctgctggcttg
gccctgggcatggtctgcttggggcatggcagcaatttgataggtatgtctgatctcaat
gtgcctgagcagctctatcagtacatggttggaggacataggcgctttcaaacaggaatg
catagggagaaacataaatcaccaagttatcaaatcaaagaaggagataccataaatgtg
gatgtgacttgtccaggtgctactctagctttggctatgatctacttaaaaaccaataac
agatctattgcagattggctccgagcccctgacaccatgtatttgttggactttgtgaag
ccagaatttctcttgcttaggacacttgctcgatgcctgattttgtgggatgatatttta
ccaaattccaagtgggttgacagcaatgttcctcaaattataagagaaaatagtatctct
ctcagtgaaatcgaattgccgtgctcagaggatttgaatttggaaactttgtcccaagca
catgtctacataattgcaggagcctgcttgtctctgggttttcgatttgctggctcagaa
aacttatcagcatttaactgtttgcataaatttgccaaagattttatgacttatttgtcc
gcacctaatgcttctgttacaggtcctcataacctagaaacttgtctgagcgtggtgctg
ctgtctctcgccatggtcatggctggctcaggaaacctaaaggttttgcagctttgtcgc
ttcttacacatgaaaacgggtggtgaaatgaactatggttttcacttagcccaccacatg
gcccttggacttctatttttgggaggaggaaggtactctttgagcacatcaaattcttcc
attgccgctcttctctgtgccctttatccgcacttcccagctcacagcactgacaaccgg
tatcatctccaggctctccggcacctctatgtgctggccgcggagcccaggcttctagtg
cctgtggatgtggacacaaacacgccctgctatgccctcttagaagttacctacaagggc
actcagtggtatgaacaaaccaaagaagaattgatggctcctacccttcttccagaactc
catcttttaaagcagattaaagtaaaaggcccaagatactgggaactgctcatagattta
agcaaaggaacacaacacttgaagtccatcctttccaaggatggggttttatatgttaaa
ctccgggcgggtcagctctcctacaaagaagatccaatgggatggcaaagtttgttggct
cagactgttgctaacaggaactctgaagcccgggctttcaagccagaaacaatctcagca
ttcacttctgatccagcacttctgtcatttgctgaatatttctgcaagccaactgtgaac
atgggtcagaaacaggaaattctggatctcttttcttcagtactctatgaatgtgttacc
caggagaccccagagatgttgcctgcatacatagcaatggatcaggctataagaagactt
gggagaagagaaatgtctgagacttctgaactttggcagataaagttggtgttagagttt
ttcagctcccgaagccatcaggagcggctgcagaaccaccctaagcgggggctctttatg
aactcggaattcctccctgttgtgaagtgcaccattgataataccctggaccagtggcta
caagtcgggggtgatatgtgtgtgcacgcctacctcagcgggcagcccttggaggaatca
cagctgagcatgctggcctgcttcctcgtctaccactctgtgccagctccacagcacctg
ccacctataggactagaagggagcacaagctttgctgaactgctcttcaaatttaagcag
ctaaaaatgccagtgcgagctttgctgagattggctcctttgcttcttggaaatccacag
ccaatggtgatgtga

DBGET integrated database retrieval system