KEGG   Homo sapiens (human): 6473Help
Entry
6473              CDS       T01001                                 

Gene name
SHOX, GCFX, PHOG, SHOXY, SS
Definition
(RefSeq) short stature homeobox
  KO
K09331  
short stature homeobox protein
Organism
hsa  Homo sapiens (human)
Disease
H00492  
SHOX-related haploinsufficiency disorders
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Prd
    6473 (SHOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
Xp22.33; Yp11.3
AA seq 292 aa AA seqDB search
MEELTAFVSKSFDQKSKDGNGGGGGGGGKKDSITYREVLESGLARSRELGTSDSSLQDIT
EGGGHCPVHLFKDHVDNDKEKLKEFGTARVAEGIYECKEKREDVKSEDEDGQTKLKQRRS
RTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQMH
KGVILGTANHLDACRVAPYVNMGALRMPFQQVQAQLQLEGVAHAHPHLHPHLAAHAPYLM
FPPPPFGLPIASLAESASAAAVVAAAAKSNSKNSSIADLRLKARKHAEALGL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggaagagctcacggcttttgtatccaagtcttttgaccagaaaagcaaggacggtaac
ggcggaggcggaggcggcggaggtaagaaggattccattacgtaccgggaagttttggag
agcggactggcgcgctcccgggagctggggacgtcggattccagcctccaggacatcacg
gagggcggcggccactgcccggtgcatttgttcaaggaccacgtagacaatgacaaggag
aaactgaaagaattcggcaccgcgagagtggcagaagggatttatgaatgcaaagagaag
cgcgaggacgtgaagtcggaggacgaggacgggcagaccaagctgaaacagaggcgcagc
cgcaccaacttcacgctggagcagctgaacgagctcgagcgactcttcgacgagacccat
taccccgacgccttcatgcgcgaggagctcagccagcgcctggggctctccgaggcgcgc
gtgcaggtttggttccagaaccggagagccaagtgccgcaaacaagagaatcagatgcat
aaaggcgtcatcttgggcacagccaaccacctagacgcctgccgagtggcaccctacgtc
aacatgggagccttacggatgcctttccaacaggtccaggctcagctgcagctggaaggc
gtggcccacgcgcacccgcacctgcacccgcacctggcggcgcacgcgccctacctgatg
ttccccccgccgcccttcgggctgcccatcgcgtcgctggccgagtccgcctcggccgcc
gccgtggtcgccgccgccgccaaaagcaacagcaagaattccagcatcgccgacctgcgg
ctcaaggcgcggaagcacgcggaggccctggggctctga

DBGET integrated database retrieval system