KEGG   Homo sapiens (human): 6473Help
Entry
6473              CDS       T01001                                 

Gene name
SHOX, GCFX, PHOG, SHOXY, SS
Definition
short stature homeobox
Orthology
K09331  
short stature homeobox protein
Organism
hsa  Homo sapiens (human)
Disease
H00492  
SHOX-related haploinsufficiency disorders
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Prd
    6473 (SHOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
Xp22.33; Yp11.3
AA seq 292 aa AA seqDB search
MEELTAFVSKSFDQKSKDGNGGGGGGGGKKDSITYREVLESGLARSRELGTSDSSLQDIT
EGGGHCPVHLFKDHVDNDKEKLKEFGTARVAEGIYECKEKREDVKSEDEDGQTKLKQRRS
RTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQMH
KGVILGTANHLDACRVAPYVNMGALRMPFQQVQAQLQLEGVAHAHPHLHPHLAAHAPYLM
FPPPPFGLPIASLAESASAAAVVAAAAKSNSKNSSIADLRLKARKHAEALGL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggaagagctcacggcttttgtatccaagtcttttgaccagaaaagcaaggacggtaac
ggcggaggcggaggcggcggaggtaagaaggattccattacgtaccgggaagttttggag
agcggactggcgcgctcccgggagctggggacgtcggattccagcctccaggacatcacg
gagggcggcggccactgcccggtgcatttgttcaaggaccacgtagacaatgacaaggag
aaactgaaagaattcggcaccgcgagagtggcagaagggatttatgaatgcaaagagaag
cgcgaggacgtgaagtcggaggacgaggacgggcagaccaagctgaaacagaggcgcagc
cgcaccaacttcacgctggagcagctgaacgagctcgagcgactcttcgacgagacccat
taccccgacgccttcatgcgcgaggagctcagccagcgcctggggctctccgaggcgcgc
gtgcaggtttggttccagaaccggagagccaagtgccgcaaacaagagaatcagatgcat
aaaggcgtcatcttgggcacagccaaccacctagacgcctgccgagtggcaccctacgtc
aacatgggagccttacggatgcctttccaacaggtccaggctcagctgcagctggaaggc
gtggcccacgcgcacccgcacctgcacccgcacctggcggcgcacgcgccctacctgatg
ttccccccgccgcccttcgggctgcccatcgcgtcgctggccgagtccgcctcggccgcc
gccgtggtcgccgccgccgccaaaagcaacagcaagaattccagcatcgccgacctgcgg
ctcaaggcgcggaagcacgcggaggccctggggctctga

DBGET integrated database retrieval system