KEGG   Homo sapiens (human): 64768Help
Entry
64768             CDS       T01001                                 

Gene name
IPPK, C9orf12, INSP5K2, IP5K, IPK1, bA476B13.1
Definition
inositol 1,3,4,5,6-pentakisphosphate 2-kinase (EC:2.7.1.158)
Orthology
K10572  
inositol-pentakisphosphate 2-kinase [EC:2.7.1.158]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    64768 (IPPK)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    64768 (IPPK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.158  inositol-pentakisphosphate 2-kinase
     64768 (IPPK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q22.31
AA seq 491 aa AA seqDB search
MEEGKMDENEWGYHGEGNKSLVVAHAQRCVVLRFLKFPPNRKKTSEEIFQHLQNIVDFGK
NVMKEFLGENYVHYGEVVQLPLEFVKQLCLKIQSERPESRCDKDLDTLSGYAMCLPNLTR
LQTYRFAEHRPILCVEIKPKCGFIPFSSDVTHEMKHKVCRYCMHQHLKVATGKWKQISKY
CPLDLYSGNKQRMHFALKSLLQEAQNNLKIFKNGELIYGCKDARSPVADWSELAHHLKPF
FFPSNGLASGPHCTRAVIRELVHVITRVLLSGSDKGRAGTLSPGLGPQGPRVCEASPFSR
SLRCQGKNTPERSGLPKGCLLYKTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQ
IDGPYDEAFYQKLLDLSTEDDGTVAFALTKVQQYRVAMTAKDCSIMIALSPCLQDASSDQ
RPVVPSSRSRFAFSVSVLDLDLKPYESIPHQYKLDGKIVNYYSKTVRAKDNAVMSTRFKE
SEDCTLVLHKV
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggaagaggggaagatggacgagaatgaatgggggtaccacggagagggcaataagagc
ctggtggtggcccacgcgcagcgctgcgtcgtgctgcggtttctgaagtttcctccaaat
aggaagaagacctcggaagagatatttcaacacctgcagaacatagtggactttgggaaa
aatgtcatgaaggagtttttgggggagaactatgttcattatggggaggtcgttcagcta
cctttagagtttgtgaaacagctttgtttaaagatacaatctgaaagaccagagtctcgc
tgtgacaaggacctggatactctcagtggttacgctatgtgccttcctaatttaaccaga
ctccaaacctaccgctttgcagagcaccggccgattctgtgtgtagagattaagccaaaa
tgtgggtttattcctttctcgagtgatgtcacgcatgagatgaagcataaggtctgtcga
tactgcatgcaccagcacctcaaggtagcaactgggaagtggaagcagatcagcaaatac
tgtccccttgatctctactcaggaaacaaacagagaatgcactttgccttgaagagtttg
ctgcaggaggcacagaacaacttgaagatatttaagaatggtgagctgatttacggctgc
aaagatgcccggagccccgtggctgactggagcgagcttgcacaccacctgaagccgttc
ttcttcccttccaacggcctggccagtgggccccactgcacaagggctgtgatcagggag
ctggtgcacgtgatcacacgggtgctgctgagtggctcggacaagggccgggcaggcacc
ctgagtccggggctcgggcctcagggcccgcgagtctgcgaagccagccctttcagtagg
agccttcgctgccaaggaaaaaacaccccagagcgctcggggttaccgaagggctgtctt
ctgtacaaaaccctccaggtgcagatgttggacctgctggacatcgaaggcctctaccct
ctgtacaaccgggttgagcgatacctggaagagtttcccgaggagagaaaaaccttacaa
atagatgggccttatgatgaagcattttaccagaagctgcttgacctttccactgaggat
gacgggacagtggccttcgcgctaacgaaggtgcagcagtaccgcgtcgccatgactgcc
aaggactgctccatcatgattgcactgtctccctgtctgcaggatgccagctctgatcaa
aggcctgtcgtcccttcatcgaggtccaggtttgccttttccgtgtctgtgctggacctt
gacctcaagccctacgagagcattccccatcagtataaactggacggcaagatcgtcaac
tattattcaaagactgtacgtgccaaagacaacgccgtgatgtcgactcggttcaaggaa
agcgaagattgcacattagttctccacaaggtctaa

DBGET integrated database retrieval system