KEGG   Homo sapiens (human): 64768Help
Entry
64768             CDS       T01001                                 

Gene name
IPPK, C9orf12, INSP5K2, IP5K, IPK1, bA476B13.1
Definition
inositol 1,3,4,5,6-pentakisphosphate 2-kinase (EC:2.7.1.158)
Orthology
K10572  
inositol-pentakisphosphate 2-kinase [EC:2.7.1.158]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:hsa00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:hsa04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q22.31
AA seq 491 aa AA seqDB search
MEEGKMDENEWGYHGEGNKSLVVAHAQRCVVLRFLKFPPNRKKTSEEIFQHLQNIVDFGK
NVMKEFLGENYVHYGEVVQLPLEFVKQLCLKIQSERPESRCDKDLDTLSGYAMCLPNLTR
LQTYRFAEHRPILCVEIKPKCGFIPFSSDVTHEMKHKVCRYCMHQHLKVATGKWKQISKY
CPLDLYSGNKQRMHFALKSLLQEAQNNLKIFKNGELIYGCKDARSPVADWSELAHHLKPF
FFPSNGLASGPHCTRAVIRELVHVITRVLLSGSDKGRAGTLSPGLGPQGPRVCEASPFSR
SLRCQGKNTPERSGLPKGCLLYKTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQ
IDGPYDEAFYQKLLDLSTEDDGTVAFALTKVQQYRVAMTAKDCSIMIALSPCLQDASSDQ
RPVVPSSRSRFAFSVSVLDLDLKPYESIPHQYKLDGKIVNYYSKTVRAKDNAVMSTRFKE
SEDCTLVLHKV
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggaagaggggaagatggacgagaatgaatgggggtaccacggagagggcaataagagc
ctggtggtggcccacgcgcagcgctgcgtcgtgctgcggtttctgaagtttcctccaaat
aggaagaagacctcggaagagatatttcaacacctgcagaacatagtggactttgggaaa
aatgtcatgaaggagtttttgggggagaactatgttcattatggggaggtcgttcagcta
cctttagagtttgtgaaacagctttgtttaaagatacaatctgaaagaccagagtctcgc
tgtgacaaggacctggatactctcagtggttacgctatgtgccttcctaatttaaccaga
ctccaaacctaccgctttgcagagcaccggccgattctgtgtgtagagattaagccaaaa
tgtgggtttattcctttctcgagtgatgtcacgcatgagatgaagcataaggtctgtcga
tactgcatgcaccagcacctcaaggtagcaactgggaagtggaagcagatcagcaaatac
tgtccccttgatctctactcaggaaacaaacagagaatgcactttgccttgaagagtttg
ctgcaggaggcacagaacaacttgaagatatttaagaatggtgagctgatttacggctgc
aaagatgcccggagccccgtggctgactggagcgagcttgcacaccacctgaagccgttc
ttcttcccttccaacggcctggccagtgggccccactgcacaagggctgtgatcagggag
ctggtgcacgtgatcacacgggtgctgctgagtggctcggacaagggccgggcaggcacc
ctgagtccggggctcgggcctcagggcccgcgagtctgcgaagccagccctttcagtagg
agccttcgctgccaaggaaaaaacaccccagagcgctcggggttaccgaagggctgtctt
ctgtacaaaaccctccaggtgcagatgttggacctgctggacatcgaaggcctctaccct
ctgtacaaccgggttgagcgatacctggaagagtttcccgaggagagaaaaaccttacaa
atagatgggccttatgatgaagcattttaccagaagctgcttgacctttccactgaggat
gacgggacagtggccttcgcgctaacgaaggtgcagcagtaccgcgtcgccatgactgcc
aaggactgctccatcatgattgcactgtctccctgtctgcaggatgccagctctgatcaa
aggcctgtcgtcccttcatcgaggtccaggtttgccttttccgtgtctgtgctggacctt
gacctcaagccctacgagagcattccccatcagtataaactggacggcaagatcgtcaac
tattattcaaagactgtacgtgccaaagacaacgccgtgatgtcgactcggttcaaggaa
agcgaagattgcacattagttctccacaaggtctaa

DBGET integrated database retrieval system