KEGG   Homo sapiens (human): 6477Help
Entry
6477              CDS       T01001                                 

Gene name
SIAH1, SIAH1A
Definition
(RefSeq) siah E3 ubiquitin protein ligase 1
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    6477 (SIAH1)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    6477 (SIAH1)
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    6477 (SIAH1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     6477 (SIAH1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    6477 (SIAH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sina
Motif
Other DBs
NCBI-GeneID: 6477
NCBI-ProteinID: NP_003022
OMIM: 602212
HGNC: 10857
Ensembl: ENSG00000196470
Vega: OTTHUMG00000175417
Pharos: Q8IUQ4(Tbio)
UniProt: Q8IUQ4
Structure
PDB: 

Jmol
Position
16q12.1
AA seq 282 aa AA seqDB search
MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHL
VCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEEL
CEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVM
MQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATP
RSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtcagactgctacagcattacctaccggtacctcgaagtgtccaccatcccag
agggtgcctgccctgactggcacaactgcatccaacaatgacttggcgagtctttttgag
tgtccagtctgctttgactatgtgttaccgcccattcttcaatgtcagagtggccatctt
gtttgtagcaactgtcgcccaaagctcacatgttgtccaacttgccggggccctttggga
tccattcgcaacttggctatggagaaagtggctaattcagtacttttcccctgtaaatat
gcgtcttctggatgtgaaataactctgccacacacagaaaaagcagaccatgaagagctc
tgtgagtttaggccttattcctgtccgtgccctggtgcttcctgtaaatggcaaggctct
ctggatgctgtaatgccccatctgatgcatcagcataagtccattacaaccctacaggga
gaggatatagtttttcttgctacagacattaatcttcctggtgctgttgactgggtgatg
atgcagtcctgttttggctttcacttcatgttagtcttagagaaacaggaaaaatacgat
ggtcaccagcagttcttcgcaatcgtacagctgataggaacacgcaagcaagctgaaaat
tttgcttaccgacttgagctaaatggtcataggcgacgattgacttgggaagcgactcct
cgatctattcatgaaggaattgcaacagccattatgaatagcgactgtctagtctttgac
accagcattgcacagctttttgcagaaaatggcaatttaggcatcaatgtaactatttcc
atgtgttga

DBGET integrated database retrieval system