KEGG   Homo sapiens (human): 6477Help
Entry
6477              CDS       T01001                                 

Gene name
SIAH1, SIAH1A
Definition
siah E3 ubiquitin protein ligase 1 (EC:6.3.2.-)
Orthology
K04506  
E3 ubiquitin-protein ligase SIAH1 [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
Ubiquitin mediated proteolysis
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    6477 (SIAH1)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    6477 (SIAH1)
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    6477 (SIAH1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     6477 (SIAH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q12.1
AA seq 313 aa AA seqDB search
MTGKATPPSLYSWRGVLFTCLPAARTRKRKEMSRQTATALPTGTSKCPPSQRVPALTGTT
ASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEK
VANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLM
HQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIV
QLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAE
NGNLGINVTISMC
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaaaggctactccaccttctctgtactcctggaggggagtcttgttcacatgt
ttaccagcggccaggacaaggaagagaaaagaaatgagccgtcagactgctacagcatta
cctaccggtacctcgaagtgtccaccatcccagagggtgcctgccctgactggcacaact
gcatccaacaatgacttggcgagtctttttgagtgtccagtctgctttgactatgtgtta
ccgcccattcttcaatgtcagagtggccatcttgtttgtagcaactgtcgcccaaagctc
acatgttgtccaacttgccggggccctttgggatccattcgcaacttggctatggagaaa
gtggctaattcagtacttttcccctgtaaatatgcgtcttctggatgtgaaataactctg
ccacacacagaaaaagcagaccatgaagagctctgtgagtttaggccttattcctgtccg
tgccctggtgcttcctgtaaatggcaaggctctctggatgctgtaatgccccatctgatg
catcagcataagtccattacaaccctacagggagaggatatagtttttcttgctacagac
attaatcttcctggtgctgttgactgggtgatgatgcagtcctgttttggctttcacttc
atgttagtcttagagaaacaggaaaaatacgatggtcaccagcagttcttcgcaatcgta
cagctgataggaacacgcaagcaagctgaaaattttgcttaccgacttgagctaaatggt
cataggcgacgattgacttgggaagcgactcctcgatctattcatgaaggaattgcaaca
gccattatgaatagcgactgtctagtctttgacaccagcattgcacagctttttgcagaa
aatggcaatttaggcatcaatgtaactatttccatgtgttga

DBGET integrated database retrieval system