KEGG   Homo sapiens (human): 6480Help
Entry
6480              CDS       T01001                                 

Gene name
ST6GAL1, SIAT1, ST6GalI, ST6N
Definition
ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 (EC:2.4.99.1)
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    6480 (ST6GAL1)
   00514 Other types of O-glycan biosynthesis
    6480 (ST6GAL1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     6480 (ST6GAL1)
Glycosyltransferases [BR:hsa01003]
 Terminal extension
  Sialyltransferase
   6480 (ST6GAL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q27-q28
AA seq 406 aa AA seqDB search
MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDS
QSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMN
KYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGP
WGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTE
KRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQM
PWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFF
DSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgattcacaccaacctgaagaaaaagttcagctgctgcgtcctggtctttcttctgttt
gcagtcatctgtgtgtggaaggaaaagaagaaagggagttactatgattcctttaaattg
caaaccaaggaattccaggtgttaaagagtctggggaaattggccatggggtctgattcc
cagtctgtatcctcaagcagcacccaggacccccacaggggccgccagaccctcggcagt
ctcagaggcctagccaaggccaaaccagaggcctccttccaggtgtggaacaaggacagc
tcttccaaaaaccttatccctaggctgcaaaagatctggaagaattacctaagcatgaac
aagtacaaagtgtcctacaaggggccaggaccaggcatcaagttcagtgcagaggccctg
cgctgccacctccgggaccatgtgaatgtatccatggtagaggtcacagattttcccttc
aatacctctgaatgggagggttatctgcccaaggagagcattaggaccaaggctgggcct
tggggcaggtgtgctgttgtgtcgtcagcgggatctctgaagtcctcccaactaggcaga
gaaatcgatgatcatgacgcagtcctgaggtttaatggggcacccacagccaacttccaa
caagatgtgggcacaaaaactaccattcgcctgatgaactctcagttggttaccacagag
aagcgcttcctcaaagacagtttgtacaatgaaggaatcctaattgtatgggacccatct
gtataccactcagatatcccaaagtggtaccagaatccggattataatttctttaacaac
tacaagacttatcgtaagctgcaccccaatcagcccttttacatcctcaagccccagatg
ccttgggagctatgggacattcttcaagaaatctccccagaagagattcagccaaacccc
ccatcctctgggatgcttggtatcatcatcatgatgacgctgtgtgaccaggtggatatt
tatgagttcctcccatccaagcgcaagactgacgtgtgctactactaccagaagttcttc
gatagtgcctgcacgatgggtgcctaccacccgctgctctatgagaagaatttggtgaag
catctcaaccagggcacagatgaggacatctacctgcttggaaaagccacactgcctggc
ttccggaccattcactgctaa

DBGET integrated database retrieval system