KEGG   Homo sapiens (human): 64802Help
Entry
64802             CDS       T01001                                 

Gene name
NMNAT1, LCA9, NMNAT, PNAT1
Definition
nicotinamide nucleotide adenylyltransferase 1 (EC:2.7.7.1 2.7.7.18)
Orthology
K06210  
nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
hsa  Homo sapiens (human)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:hsa00760]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.22
AA seq 279 aa AA seqDB search
MENSEKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGL
IPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTL
ERPGRKRKWTETQDSSQKKSLEPKTKAVPKVKLLCGADLLESFAVPNLWKSEDITQIVAN
YGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLV
PDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTAEAKT
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattccgagaagactgaagtggttctccttgcttgtggttcattcaatcccatc
accaacatgcacctcaggttgtttgagctggccaaggactacatgaatggaacaggaagg
tacacagttgtcaaaggcatcatctctcctgttggtgatgcctacaagaagaaaggactc
attcctgcctatcaccgggtcatcatggcagaacttgctaccaagaattctaaatgggtg
gaagttgatacatgggaaagtcttcagaaggagtggaaagagactctgaaggtgctaaga
caccatcaagagaaattggaggctagtgactgtgatcaccagcagaactcacctactcta
gaaaggcctggaaggaagaggaagtggactgaaacacaagattctagtcaaaagaaatcc
ctagagccaaaaacaaaagctgtgccaaaggtcaagctgctgtgtggggcagatttattg
gagtcctttgctgttcccaatttgtggaagagtgaagacatcacccaaatcgtggccaac
tatgggctcatatgtgttactcgggctggaaatgatgctcagaagtttatctatgaatcg
gatgtgctgtggaaacaccggagcaacattcacgtggtgaatgaatggatcgctaatgac
atctcatccacaaaaatccggagagccctcagaaggggccagagcattcgctacttggta
ccagatcttgtccaagaatacattgaaaagcataatttgtacagctctgagagtgaagac
aggaatgctggggtcatcctggcccctttgcagagaaacactgcagaagctaagacatag

DBGET integrated database retrieval system