KEGG   Homo sapiens (human): 64805Help
Entry
64805             CDS       T01001                                 

Gene name
P2RY12, ADPG-R, BDPLT8, HORK3, P2T(AC), P2Y(12)R, P2Y(AC), P2Y(ADP), P2Y(cyc), P2Y12, SP1999
Definition
(RefSeq) purinergic receptor P2Y12
  KO
K04298  purinergic receptor P2Y, G protein-coupled, 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04611  Platelet activation
Disease
H01235  Bleeding disorder platelet-type
Drug target
Cangrelor (DG01294): D03359 D03361
Clopidogrel (DG00155): D00769 D07729 D10823 D10824
Elinogrel (DG01295): D09607 D09608
Prasugrel: D05597
Regrelor disodium: D08983
Ticagrelor: D09017
Ticlopidine (DG00156): D01028 D08594
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04611 Platelet activation
    64805 (P2RY12)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    64805 (P2RY12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 64805
NCBI-ProteinID: NP_073625
OMIM: 600515
HGNC: 18124
Ensembl: ENSG00000169313
Vega: OTTHUMG00000159863
Pharos: Q9H244(Tclin)
UniProt: Q9H244 A8K7T1
Position
3q25.1
AA seq 342 aa AA seqDB search
MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFI
IFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITI
DRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKS
EFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFI
IIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFF
LCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccgtcgacaacctcacctctgcgcctggtaacaccagtctgtgcaccagagac
tacaaaatcacccaggtcctcttcccactgctctacactgtcctgttttttgttggactt
atcacaaatggcctggcgatgaggattttctttcaaatccggagtaaatcaaactttatt
atttttcttaagaacacagtcatttctgatcttctcatgattctgacttttccattcaaa
attcttagtgatgccaaactgggaacaggaccactgagaacttttgtgtgtcaagttacc
tccgtcatattttatttcacaatgtatatcagtatttcattcctgggactgataactatc
gatcgctaccagaagaccaccaggccatttaaaacatccaaccccaaaaatctcttgggg
gctaagattctctctgttgtcatctgggcattcatgttcttactctctttgcctaacatg
attctgaccaacaggcagccgagagacaagaatgtgaagaaatgctctttccttaaatca
gagttcggtctagtctggcatgaaatagtaaattacatctgtcaagtcattttctggatt
aatttcttaattgttattgtatgttatacactcattacaaaagaactgtaccggtcatac
gtaagaacgaggggtgtaggtaaagtccccaggaaaaaggtgaacgtcaaagttttcatt
atcattgctgtattctttatttgttttgttcctttccattttgcccgaattccttacacc
ctgagccaaacccgggatgtctttgactgcactgctgaaaatactctgttctatgtgaaa
gagagcactctgtggttaacttccttaaatgcatgcctggatccgttcatctattttttc
ctttgcaagtccttcagaaattccttgataagtatgctgaagtgccccaattctgcaaca
tctctgtcccaggacaataggaaaaaagaacaggatggtggtgacccaaatgaagagact
ccaatgtaa

DBGET integrated database retrieval system