KEGG   Homo sapiens (human): 64806Help
Entry
64806             CDS       T01001                                 

Gene name
IL25, IL17E
Definition
interleukin 25
Orthology
K05493  
interleukin 17E
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    64806 (IL25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q11.2
AA seq 177 aa AA seqDB search
MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVP
PLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQT
GSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgagggagcgacccagattaggtgaggacagttctctcattagccttttcctacaggtg
gttgcattcttggcaatggtcatgggaacccacacctacagccactggcccagctgctgc
cccagcaaagggcaggacacctctgaggagctgctgaggtggagcactgtgcctgtgcct
cccctagagcctgctaggcccaaccgccacccagagtcctgtagggccagtgaagatgga
cccctcaacagcagggccatctccccctggagatatgagttggacagagacttgaaccgg
ctcccccaggacctgtaccacgcccgttgcctgtgcccgcactgcgtcagcctacagaca
ggctcccacatggacccccggggcaactcggagctgctctaccacaaccagactgtcttc
taccggcggccatgccatggcgagaagggcacccacaagggctactgcctggagcgcagg
ctgtaccgtgtttccttagcttgtgtgtgtgtgcggccccgtgtgatgggctag

DBGET integrated database retrieval system