KEGG   Homo sapiens (human): 64816Help
Entry
64816             CDS       T01001                                 

Gene name
CYP3A43
Definition
(RefSeq) cytochrome P450 family 3 subfamily A member 43 (EC:1.14.14.1)
  KO
K17692  
cytochrome P450, family 3, subfamily A, polypeptide 43 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
Chemical carcinogenesis
Drug target
Cobicistat: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    64816 (CYP3A43)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     64816 (CYP3A43)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP3 family
   64816 (CYP3A43)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q21.1
AA seq 503 aa AA seqDB search
MDLIPNFAMETWVLVATSLVLLYIYGTHSHKLFKKLGIPGPTPLPFLGTILFYLRGLWNF
DRECNEKYGEMWGLYEGQQPMLVIMDPDMIKTVLVKECYSVFTNQMPLGPMGFLKSALSF
AEDEEWKRIRTLLSPAFTSVKFKEMVPIISQCGDMLVRSLRQEAENSKSINLKDFFGAYT
MDVITGTLFGVNLDSLNNPQDPFLKNMKKLLKLDFLDPFLLLISLFPFLTPVFEALNIGL
FPKDVTHFLKNSIERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSI
IIIFAAYDTTSTTLPFIMYELATHPDVQQKLQEEIDAVLPNKAPVTYDALVQMEYLDMVV
NETLRLFPVVSRVTRVCKKDIEINGVFIPKGLAVMVPIYALHHDPKYWTEPEKFCPERFS
KKNKDSIDLYRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFSFKPCKETQIPLKLDNL
PILQPEKPIVLKVHLRDGITSGP
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggatctcattccaaactttgccatggaaacatgggttcttgtggctaccagcctggta
ctcctctatatttatgggacccattcacataaactttttaagaagctgggaattcctggg
ccaacccctctgccttttctgggaactattttgttctaccttaggggtctttggaatttt
gacagagaatgtaatgaaaaatacggagaaatgtgggggctgtatgaggggcaacagccc
atgctggtcatcatggatcccgacatgatcaaaacagtgttagtgaaagaatgttactct
gtcttcacaaaccagatgcctttaggtccaatgggatttctgaaaagtgccttaagtttt
gctgaagatgaagaatggaagagaatacgaacattgctatctccagctttcaccagtgta
aaattcaaggaaatggtccccatcatttcccaatgtggagatatgttggtgagaagcctg
aggcaggaagcagagaacagcaagtccatcaacttgaaagatttctttggggcctacacc
atggatgtaatcactggcacattatttggagtgaacttggattctctcaacaatccacaa
gatccctttctgaaaaatatgaagaagcttttaaaattggattttttggatcccttttta
ctcttaatatcactctttccatttcttaccccagtttttgaagccctaaatatcggtttg
tttccaaaagatgttacccattttttaaaaaattccattgaaaggatgaaagaaagtcgc
ctcaaagataaacaaaagcatcgagtagatttctttcaacagatgatcgactcccagaat
tccaaagaaacaaagtcccataaagctctgtctgatctggagcttgtggcccagtcaatt
atcatcatttttgctgcctatgacacaactagcaccactctccccttcattatgtatgaa
ctggccactcaccctgatgtccagcagaaactgcaggaggagattgacgcagttttaccc
aataaggcacctgtcacctacgatgccctggtacagatggagtaccttgacatggtggtg
aatgaaacgctcagattattcccagttgttagtagagttacgagagtctgcaagaaagat
attgaaatcaatggagtgttcattcccaaagggttagcagtgatggttccaatctatgct
cttcaccatgacccaaagtactggacagagcctgagaagttctgccctgaaaggttcagt
aagaagaacaaggacagcatagatctttacagatacataccttttggagctggaccccga
aactgcattggcatgaggtttgctctcacaaacataaaacttgctgtcattagagcactg
cagaacttctccttcaaaccttgtaaagagactcagatcccactgaaattagacaatcta
ccaattcttcaaccagaaaaacctattgttctaaaagtgcacttaagagatgggattaca
agtggaccctga

DBGET integrated database retrieval system