KEGG   Homo sapiens (human): 649Help
Entry
649               CDS       T01001                                 

Gene name
BMP1, OI13, PCOLC, PCP, PCP2, TLD
Definition
(RefSeq) bone morphogenetic protein 1 (EC:3.4.24.19)
  KO
K05502  
bone morphogenetic protein 1 [EC:3.4.24.19]
Organism
hsa  Homo sapiens (human)
Disease
H00506  
Osteogenesis imperfecta
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.19  procollagen C-endopeptidase
     649 (BMP1)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   649 (BMP1)
Cytokines [BR:hsa04052]
 TGF-beta family
  Distant members
   649 (BMP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p21.3
AA seq 986 aa AA seqDB search
MPGVARLPLLLGLLLLPRPGRPLDLADYTYDLAEEDDSEPLNYKDPCKAAAFLGDIALDE
EDLRAFQVQQAVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRR
AATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTY
RPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVREN
IQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPPIG
QRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKI
ILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSS
NWVGKGFFAVYEAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSF
EIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGF
AVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNG
SITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSK
LHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVN
TFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSKKECTWAISST
PGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGSRMFLR
FYSDNSVQRKGFQASHATECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGY
GVELVFQTFEVEEETDCGYDYMELFDGYDSTAPRLGRYCGSGPPEEVYSAGDSVLVKFHS
DDTITKKGFHLRYTSTKFQDTLHSRK
NT seq 2961 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcgtggcccgcctgccgctgctgctcgggctgctgctgctcccgcgtcccggc
cggccgctggacttggccgactacacctatgacctggcggaggaggacgactcggagccc
ctcaactacaaagacccctgcaaggcggctgcctttcttggggacattgccctggacgaa
gaggacctgagggccttccaggtacagcaggctgtggatctcagacggcacacagctcgt
aagtcctccatcaaagctgcagttccaggaaacacttctacccccagctgccagagcacc
aacgggcagcctcagaggggagcctgtgggagatggagaggtagatcccgtagccggcgg
gcggcgacgtcccgaccagagcgtgtgtggcccgatggggtcatcccctttgtcattggg
ggaaacttcactggtagccagagggcagtcttccggcaggccatgaggcactgggagaag
cacacctgtgtcaccttcctggagcgcactgacgaggacagctatattgtgttcacctat
cgaccttgcgggtgctgctcctacgtgggtcgccgcggcgggggcccccaggccatctcc
atcggcaagaactgtgacaagttcggcattgtggtccacgagctgggccacgtcgtcggc
ttctggcacgaacacactcggccagaccgggaccgccacgtttccatcgttcgtgagaac
atccagccagggcaggagtataacttcctgaagatggagcctcaggaggtggagtccctg
ggggagacctatgacttcgacagcatcatgcattacgctcggaacacattctccaggggc
atcttcctggataccattgtccccaagtatgaggtgaacggggtgaaacctcccattggc
caaaggacacggctcagcaagggggacattgcccaagcccgcaagctttacaagtgccca
gcctgtggagagaccctgcaagacagcacaggcaacttctcctcccctgaataccccaat
ggctactctgctcacatgcactgcgtgtggcgcatctctgtcacacccggggagaagatc
atcctgaacttcacgtccctggacctgtaccgcagccgcctgtgctggtacgactatgtg
gaggtccgagatggcttctggaggaaggcgcccctccgaggccgcttctgcgggtccaaa
ctccctgagcctatcgtctccactgacagccgcctctgggttgaattccgcagcagcagc
aattgggttggaaagggcttctttgcagtctacgaagccatctgcgggggtgatgtgaaa
aaggactatggccacattcaatcgcccaactacccagacgattaccggcccagcaaagtc
tgcatctggcggatccaggtgtctgagggcttccacgtgggcctcacattccagtccttt
gagattgagcgccacgacagctgtgcctacgactatctggaggtgcgcgacgggcacagt
gagagcagcaccctcatcgggcgctactgtggctatgagaagcctgatgacatcaagagc
acgtccagccgcctctggctcaagttcgtctctgacgggtccattaacaaagcgggcttt
gccgtcaactttttcaaagaggtggacgagtgctctcggcccaaccgcgggggctgtgag
cagcggtgcctcaacaccctgggcagctacaagtgcagctgtgaccccgggtacgagctg
gccccagacaagcgccgctgtgaggctgcttgtggcggattcctcaccaagctcaacggc
tccatcaccagcccgggctggcccaaggagtacccccccaacaagaactgcatctggcag
ctggtggcccccacccagtaccgcatctccctgcagtttgacttctttgagacagagggc
aatgatgtgtgcaagtacgacttcgtggaggtgcgcagtggactcacagctgactccaag
ctgcatggcaagttctgtggttctgagaagcccgaggtcatcacctcccagtacaacaac
atgcgcgtggagttcaagtccgacaacaccgtgtccaaaaagggcttcaaggcccacttc
ttctcagacaaggacgagtgctccaaggataacggcggctgccagcaggactgcgtcaac
acgttcggcagttatgagtgccaatgccgcagtggcttcgtcctccatgacaacaagcac
gactgcaaagaagccggctgtgaccacaaggtgacatccaccagtggtaccatcaccagc
cccaactggcctgacaagtatcccagcaagaaggagtgcacgtgggccatctccagcacc
cccgggcaccgggtcaagctgaccttcatggagatggacatcgagtcccagcctgagtgt
gcctacgaccacctagaggtgttcgacgggcgagacgccaaggcccccgtcctcggccgc
ttctgtgggagcaagaagcccgagcccgtcctggccacaggcagccgcatgttcctgcgc
ttctactcagataactcggtccagcgaaagggcttccaggcctcccacgccacagagtgc
gggggccaggtacgggcagacgtgaagaccaaggacctttactcccacgcccagtttggc
gacaacaactaccctgggggtgtggactgtgagtgggtcattgtggccgaggaaggctac
ggcgtggagctcgtgttccagacctttgaggtggaggaggagaccgactgcggctatgac
tacatggagctcttcgacggctacgacagcacagcccccaggctggggcgctactgtggc
tcagggcctcctgaggaggtgtactcggcgggagattctgtcctggtgaagttccactcg
gatgacaccatcaccaaaaaaggtttccacctgcgatacaccagcaccaagttccaggac
acactccacagcaggaagtga

DBGET integrated database retrieval system