KEGG   Homo sapiens (human): 6495Help
Entry
6495              CDS       T01001                                 

Gene name
SIX1, BOS3, DFNA23, TIP39
Definition
SIX homeobox 1
Orthology
K15614  
homeobox protein SIX1
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Disease
H00453  
Contiguous gene deletion syndrome involving EYA1
H00604  
Deafness, autosomal dominant
Class
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
14q23.1
AA seq 284 aa AA seqDB search
MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHR
GNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRT
IWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDR
AAEAKERENTENNNSSSNKQNQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLLQGNMGH
ARSSNYSLPGLTASQPSHGLQTHQHQLQDSLLGPLTSSLVDLGS
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgctgccgtcgtttggctttacgcaggagcaagtggcgtgcgtgtgcgaggtt
ctgcagcaaggcggaaacctggagcgcctgggcaggttcctgtggtcactgcccgcctgc
gaccacctgcacaagaacgagagcgtactcaaggccaaggcggtggtcgccttccaccgc
ggcaacttccgtgagctctacaagatcctggagagccaccagttctcgcctcacaaccac
cccaaactgcagcaactgtggctgaaggcgcattacgtggaggccgagaagctgcgcggc
cgacccctgggcgccgtgggcaaatatcgggtgcgccgaaaatttccactgccgcgcacc
atctgggacggcgaggagaccagctactgcttcaaggagaagtcgaggggtgtcctgcgg
gagtggtacgcgcacaatccctacccatcgccgcgtgagaagcgggagctggccgaggcc
accggcctcaccaccacccaggtcagcaactggtttaagaaccggaggcaaagagaccgg
gccgcggaggccaaggaaagggagaacaccgaaaacaataactcctcctccaacaagcag
aaccaactctctcctctggaagggggcaagccgctcatgtccagctcagaagaggaattc
tcacctccccaaagtccagaccagaactcggtccttctgctgcagggcaatatgggccac
gccaggagctcaaactattctctcccgggcttaacagcctcgcagcccagtcacggcctg
cagacccaccagcatcagctccaagactctctgctcggccccctcacctccagtctggtg
gacttggggtcctaa

DBGET integrated database retrieval system