KEGG   Homo sapiens (human): 6498Help
Entry
6498              CDS       T01001                                 

Gene name
SKIL, SNO, SnoA, SnoI, SnoN
Definition
(RefSeq) SKI-like proto-oncogene
  KO
K18499  
Ski-like protein
Organism
hsa  Homo sapiens (human)
Pathway
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community
   04550 Signaling pathways regulating pluripotency of stem cells
    6498 (SKIL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q26
AA seq 684 aa AA seqDB search
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEA
PVETDGEHVKRTCTSVPETLHLNPSLKHTLAQFHLSSQSSLGGPAAFSARHSQESMSPTV
FLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFP
QNGSVLPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAP
QTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKTDAPSGMELQSWYPVIKQEGDHVSQTHSFLHPSYYLYMCDKVVAPNVSLTSAVS
QSKELTKTEASKSISRQSEKAHSSGKLQKTVSYPDVSLEEQEKMDLKTSRELCSRLDASI
SNNSTSKRKSESATCNLVRDINKVGIGLVAAASSPLLVKDVICEDDKGKIMEEVMRTYLK
QQEKLNLILQKKQQLQMEVKMLSSSKSMKELTEEQQNLQKELESLQNEHAQRMEEFYVEQ
KDLEKKLEQIMKQKCTCDSNLEKDKEAEYAGQLAELRQRLDHAEADRQELQDELRQEREA
RQKLEMMIKELKLQILKSSKTAKE
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacctccagacaaatttctccttggttcagggctcaactaaaaaactgaatggg
atgggagatgatggcagccccccagcgaaaaaaatgataacggacattcatgcaaatgga
aaaacgataaacaaggtgccaacagttaagaaggaacacttggatgactatggagaagca
ccagtggaaactgatggagagcatgttaagcgaacctgtacttctgttcctgaaactttg
catttaaatcccagtttgaaacacacattggcacaattccatttaagtagtcagagctcg
ctgggtggaccagcagcattttctgctcggcattcccaagaaagcatgtcgcctactgta
tttctgcctcttccatcacctcaggttcttcctggcccattgctcatcccttcagatagc
tccacagaactcactcagactgtgttggaaggggaatctatttcttgttttcaagttgga
ggagaaaagagactctgtttgccccaagtcttaaattctgttctccgagaatttacactc
cagcaaataaatacagtgtgtgatgaactgtacatatattgttcaaggtgtacttcagac
cagcttcatatcttaaaggtactgggcatacttccattcaatgccccatcctgtgggctg
attacattaactgatgcacaaagattatgtaatgctttattgcggccacgaacttttcct
caaaatggtagcgtacttcctgctaaaagctcattggcccagttaaaggaaactggcagt
gcctttgaagtggagcatgaatgcctaggcaaatgtcagggtttatttgcaccccagttt
tatgttcagcctgatgctccgtgtattcaatgtctggagtgttgtggaatgtttgcaccc
cagacgtttgtgatgcattctcacagatcacctgacaaaagaacttgccactggggcttt
gaatcagctaaatggcattgctatcttcatgtgaaccaaaaatacttaggaacacctgaa
gaaaagaaactgaagataattttagaagaaatgaaggagaagtttagcatgagaagtgga
aagagaaatcaatccaagacagatgcaccatcaggaatggaattacagtcatggtatcct
gttataaagcaggaaggtgaccatgtttctcagacacattcatttttacaccccagctac
tacttatacatgtgtgataaagtggttgccccaaatgtgtcacttacttctgctgtatcc
cagtctaaagagctcacaaagacagaggcaagtaagtccatatcaagacagtcagagaag
gctcacagtagtggtaaacttcaaaaaacagtgtcttatccagatgtctcacttgaggaa
caggagaaaatggatttaaaaacaagtagagaattatgtagccgtttagatgcatcaatc
tcaaataattctacaagtaaaaggaaatctgagtctgccacttgcaacttagtcagagac
ataaacaaagtgggaattggccttgttgctgccgcttcatctccgcttcttgtgaaagat
gtcatttgtgaggatgataagggaaaaatcatggaagaagtaatgagaacttatttaaaa
caacaggaaaaactaaacttgattttgcaaaagaagcaacaacttcagatggaagtaaaa
atgttgagtagttcaaaatctatgaaggaactcactgaagaacagcagaatttacagaaa
gagcttgaatctttgcagaatgaacatgctcaaagaatggaagaattttatgttgaacag
aaagacttagagaaaaaattggagcagataatgaagcaaaaatgtacctgtgactcaaat
ttagaaaaagacaaagaggctgaatatgcaggacagttggcagaactgaggcagagattg
gaccatgctgaggccgataggcaagaactccaagatgaactcagacaggaacgggaagca
agacagaagttagagatgatgataaaagagctaaagctgcaaattctgaaatcatcaaag
actgctaaagaatag

DBGET integrated database retrieval system