KEGG   Homo sapiens (human): 6499Help
Entry
6499              CDS       T01001                                 

Gene name
SKIV2L, 170A, DDX13, HLP, SKI2, SKI2W, SKIV2, SKIV2L1, THES2
Definition
(RefSeq) Ski2 like RNA helicase
  KO
K12599  
antiviral helicase SKI2 [EC:3.6.4.-]
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Module
Ski complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    6499 (SKIV2L)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     6499 (SKIV2L)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     6499 (SKIV2L)
  mRNA degradation factors
   3'-5' decay
    Ski complex
     6499 (SKIV2L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q15477(Tbio)
UniProt: 
Position
6p21.33
AA seq 1246 aa AA seqDB search
MMETERLVLPPPDPLDLPLRAVELGCTGHWELLNLPGAPESSLPHGLPPCAPDLQQEAEQ
LFLSSPAWLPLHGVEHSARKWQRKTDPWSLLAVLGAPVPSDLQAQRHPTTGQILGYKEVL
LENTNLSATTSLSLRRPPGPASQSLWGNPTQYPFWPGGMDEPTITDLNTREEAEEEIDFE
KDLLTIPPGFKKGMDFAPKDCPTPAPGLLSLSCMLEPLDLGGGDEDENEAVGQPGGPRGD
TVSASPCSAPLARASSLEDLVLKEASTAVSTPEAPEPPSQEQWAIPVDATSPVGDFYRLI
PQPAFQWAFEPDVFQKQAILHLERHDSVFVAAHTSAGKTVVAEYAIALAQKHMTRTIYTS
PIKALSNQKFRDFRNTFGDVGLLTGDVQLHPEASCLIMTTEILRSMLYSGSDVIRDLEWV
IFDEVHYINDVERGVVWEEVLIMLPDHVSIILLSATVPNALEFADWIGRLKRRQIYVIST
VTRPVPLEHYLFTGNSSKTQGELFLLLDSRGAFHTKGYYAAVEAKKERMSKHAQTFGAKQ
PTHQGGPAQDRGVYLSLLASLRTRAQLPVVVFTFSRGRCDEQASGLTSLDLTTSSEKSEI
HLFLQRCLARLRGSDRQLPQVLHMSELLNRGLGVHHSGILPILKEIVEMLFSRGLVKVLF
ATETFAMGVNMPARTVVFDSMRKHDGSTFRDLLPGEYVQMAGRAGRRGLDPTGTVILLCK
GRVPEMADLHRMMMGKPSQLQSQFRLTYTMILNLLRVDALRVEDMMKRSFSEFPSRKDSK
AHEQALAELTKRLGALEEPDMTGQLVDLPEYYSWGEELTETQHMIQRRIMESVNGLKSLS
AGRVVVVKNQEHHNALGVILQVSSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDD
LVGFKLFLPEGPCDHTVVKLQPGDMAAITTKVLRVNGEKILEDFSKRQQPKFKKDPPLAA
VTTAVQELLRLAQAHPAGPPTLDPVNDLQLKDMSVVEGGLRARKLEELIQGAQCVHSPRF
PAQYLKLRERMQIQKEMERLRFLLSDQSLLLLPEYHQRVEVLRTLGYVDEAGTVKLAGRV
ACAMSSHELLLTELMFDNALSTLRPEEIAALLSGLVCQSPGDAGDQLPNTLKQGIERVRA
VAKRIGEVQVACGLNQTVEEFVGELNFGLVEVVYEWARGMPFSELAGLSGTPEGLVVRCI
QRLAEMCRSLRGAARLVGEPVLGAKMETAATLLRRDIVFAASLYTQ
NT seq 3741 nt NT seq  +upstreamnt  +downstreamnt
atgatggagacagagcgacttgtgctaccccctccagatcccctggacctaccccttcgg
gccgtggagctcggatgcacggggcactgggagctgctgaacttgcctggagctccagag
agtagccttccccatggcctccctccttgtgccccagatctgcagcaagaagcagaacag
ttgtttctgtcatccccagcctggctgcctctgcatggtgtggagcactcagcccgaaaa
tggcagaggaagacggatccctggtctcttttggctgtcctgggagccccagtcccatcc
gacctacaggcccaaagacacccaaccacaggccagatactgggttacaaagaggtcttg
ctggagaacacaaatctctcggctacaacctccttgtctcttcgccggcctccagggcca
gcctcccagtccttatggggaaatccaactcagtatcccttctggccaggggggatggat
gaacccaccataacagatctgaacacacgggaggaggctgaggaggagatagactttgag
aaagatcttcttactattccacctggtttcaagaaaggcatggactttgcaccaaaagat
tgtccaactccagctcctggactactaagccttagctgtatgttggagcctctggatttg
ggtgggggtgacgaggatgagaatgaggcagtgggacagccaggaggtcccagaggggac
actgtttcagcctctccctgcagtgctcccctggcccgagcaagcagcttggaagaccta
gtgttgaaggaagcgtccacagctgtatccaccccagaggccccagagcctccatctcag
gagcagtgggccatccctgtggacgccacctcccctgttggtgatttctatcgcctcatt
ccccagccagccttccagtgggcatttgagccagatgtgtttcagaaacaggccatcctg
cacttggaacggcatgactctgtctttgtcgcagctcacacatctgcaggaaaaacagtt
gtggctgaatatgccattgccctggcccagaaacacatgacacgcaccatctacacttcg
cccatcaaggccctgagcaaccagaagttccgggacttccgaaacacattcggggatgtg
gggctgctcaccggggatgtacagctgcatccggaggcctcctgcctcatcatgaccaca
gagatccttcgctccatgctgtacagtggctcagatgttattcgggacctggagtgggtc
atctttgatgaggttcactatatcaacgatgtcgagcgtggggtcgtgtgggaggaggtg
cttatcatgctacctgaccacgtttctatcatccttctgagtgccaccgtccccaacgcc
cttgagtttgctgactggattgggcggctgaagcgtcgtcagatctatgtgattagcact
gtaacccgccccgtgcccctggagcactatcttttcacagggaacagctccaagacccag
ggggagctctttttgttgctggactcccgaggagccttccatacaaaagggtactatgca
gctgtggaggccaagaaggagagaatgagcaaacacgcccagacctttggggccaagcag
cccacacatcaggggggccctgcacaggaccgcggagtgtacctgtccctcctggcctcc
ctccgcacacgtgcccagttgcccgtggtggtgttcaccttctcccggggccgctgtgat
gagcaggcctcaggcctcacctcccttgacctcaccaccagttcggagaagagcgagatc
cacctcttcctgcagcgctgccttgctcgcctccgtggctctgaccgccagctgccccag
gtcctgcacatgtcagagctcctgaatcgcggcctgggtgtgcaccatagcggcatcctg
cccatcctcaaggagatcgtggagatgctcttcagccgtggcctggtcaaggtcttgttt
gccacagagacctttgccatgggagtaaacatgcctgctcgtacagtagtgtttgactcc
atgcgcaaacacgatggctccaccttccgggacctgctccctggggagtatgtgcagatg
gcaggccgggcagggcggaggggcctggaccccacaggcaccgttatcctgctctgcaag
ggccgagtgcccgagatggcagacctgcaccgcatgatgatggggaagccgtcccagctg
cagtcccagttccgcctcacgtacactatgatcctcaacttgctgcgagtggatgccctc
agggtggaggacatgatgaagaggagcttctctgagtttccctcccgcaaagacagcaag
gcccatgaacaggccctggctgaactgaccaagaggctgggagctttggaggagcctgac
atgactggccaactggtcgacctgcctgaatattacagctggggggaggaactgacagag
acccagcacatgatccagcgacgcatcatggagtctgtgaacgggctgaagtctctctca
gcaggaagggtggtggttgtgaagaatcaggagcatcacaacgcattgggagtgatccta
caggtctcctcgaactccaccagcagagtattcacaaccctggtcttgtgtgataagccc
ttgtcccaggacccacaggacagggggccagccactgcagaggtgccctatccagatgac
ctcgtgggattcaagctgttcctgcctgaagggccttgtgaccacaccgtggtcaagctc
cagccaggagatatggctgccatcaccaccaaggtgctccgggtgaatggggagaagatc
ttggaggacttcagcaagaggcagcagccaaaattcaagaaggatcctccccttgcagcc
gtgaccactgctgtccaggaactgctgcgtctggctcaggcccacccagccggacctccc
accctcgaccctgtcaatgacctgcagctcaaagatatgtcagttgtagagggtgggctc
cgggcccggaagctggaggagctgatccagggggctcagtgtgtacacagcccccgtttt
cctgcccagtacctgaagctgcgggagcgaatgcagatacagaaggagatggagcggctg
cgcttcctactgtcggatcagtcattgctgctgcttcctgagtaccatcagcgagtagag
gtgctccgaaccctgggttatgtggacgaggcgggcactgtgaagctggcagggcgggtg
gcttgtgccatgagcagccatgagttgctcctcactgagctcatgtttgacaatgcactg
agcaccctgcggcctgaggagattgctgccttgctctctggcctggtctgccagagccct
ggggacgctggggatcagctcccaaacaccctcaagcagggaatagaacgtgtccgggct
gtggccaagcggattggtgaggtccaggtggcttgtggcctgaaccagacggtggaggaa
tttgtgggggagctgaattttgggctggttgaggttgtatatgagtgggcccggggcatg
cccttctccgagttggcagggctctcagggacccctgagggcctggtggtccgctgcatt
cagcgcctggctgagatgtgtcgctcactgcggggggcagcccgcctggtaggagagcct
gtgctgggtgccaagatggagacagcggctaccttgctacggcgggacatcgtatttgcg
gccagcctctacacccagtga

DBGET integrated database retrieval system