KEGG   Homo sapiens (human): 65010Help
Entry
65010             CDS       T01001                                 

Gene name
SLC26A6
Definition
solute carrier family 26 (anion exchanger), member 6
Orthology
K14704  
solute carrier family 26 (sulfate anion transporter), member 6
Organism
hsa  Homo sapiens (human)
Pathway
Mineral absorption
Class
Organismal Systems; Digestive system; Mineral absorption [PATH:hsa04978]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.3
AA seq 738 aa AA seqDB search
MDLRRRDYHMERPLLNQEHLEELGRWGSAPRTHQWRTWLQCSRARAYALLLQHLPVLVWL
PRYPVRDWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPVFGLYSSFYPVFIYFLFGTSRH
ISVGTFAVMSVMVGSVTESLAPQALNDSMINETARDAARVQVASTLSVLVGLFQVGLGLI
HFGFVVTYLSEPLVRGYTTAAAVQVFVSQLKYVFGLHLSSHSGPLSLIYTVLEVCWKLPQ
SKVGTVVTAAVAGVVLVVVKLLNDKLQQQLPMPIPGELLTLIGATGISYGMGLKHRFEVD
VVGNIPAGLVPPVAPNTQLFSKLVGSAFTIAVVGFAIAISLGKIFALRHGYRVDSNQELV
ALGLSNLIGGIFQCFPVSCSMSRSLVQESTGGNSQVAGAISSLFILLIIVKLGELFHDLP
KAVLAAIIIVNLKGMLRQLSDMRSLWKANRADLLIWLVTFTATILLNLDLGLVVAVIFSL
LLVVVRTQMPHYSVLGQVPDTDIYRDVAEYSEAKEVRGVKVFRSSATVYFANAEFYSDAL
KQRCGVDVDFLISQKKKLLKKQEQLKLKQLQKEEKLRKQAASPKGASVSINVNTSLEDMR
SNNVEDCKMMQVSSGDKMEDATANGQEDSKAPDGSTLKALGLPQPDFHSLILDLGALSFV
DTVCLKSLKNIFHDFREIEVEVYMAACHSPVVSQLEAGHFFDASITKKHLFASVHDAVTF
ALQHPRPVPDSPVSVTRL
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcggaggcgagactaccacatggaacggccgctgctgaaccaggagcatttg
gaggagctggggcgctggggctcagcacctaggacccaccagtggcggacctggttgcag
tgctcccgtgctcgggcctatgcccttctgctccaacacctcccggttttggtctggtta
ccccggtatcctgtgcgtgactggctcctgggtgacctgttatccggcctgagtgtggcc
atcatgcagcttccgcagggcttggcctacgccctcctggctggattgccccccgtgttt
ggcctctatagctccttctaccctgtcttcatctacttcctgtttggcacttcccggcac
atctccgtggggacctttgctgtcatgtctgtgatggtgggcagtgtgacagaatccctg
gccccgcaggccttgaacgactccatgatcaatgagacagccagagatgctgcccgggta
caggtggcctccacactcagtgtcctggttggcctcttccaggtggggctgggcctgatc
cacttcggcttcgtggtcacctacctgtcagaacctcttgtccgaggctataccacagct
gcagctgtgcaggtcttcgtctcacagctcaagtatgtgtttggcctccatctgagcagc
cactctgggccactgtccctcatctatacagtgctggaggtctgctggaagctgccccag
agcaaggttggcaccgtggtcactgcagctgtggctggggtggtgctcgtggtggtgaag
ctgttgaatgacaagctgcagcagcagctgcccatgccgatacccggggagctgctcacg
ctcatcggggccacaggcatctcctatggcatgggtctaaagcacagatttgaggtagat
gtcgtgggcaacatccctgcagggctggtgcccccagtggcccccaacacccagctgttc
tcaaagctcgtgggcagcgccttcaccatcgctgtggttgggtttgccattgccatctca
ctggggaagatcttcgccctgaggcacggctaccgggtggacagcaaccaggagctggtg
gccctgggcctcagtaaccttatcggaggcatcttccagtgcttccccgtgagttgctct
atgtctcggagcctggtacaggagagcaccgggggcaactcgcaggttgctggagccatc
tcttcccttttcatcctcctcatcattgtcaaacttggggaactcttccatgacctgccc
aaggcggtcctggcagccatcatcattgtgaacctgaagggcatgctgaggcagctcagc
gacatgcgctccctctggaaggccaatcgggcggatctgcttatctggctggtgaccttc
acggccaccatcttgctgaacctggaccttggcttggtggttgcggtcatcttctccctg
ctgctcgtggtggtccggacacagatgccccactactctgtcctggggcaggtgccagac
acggatatttacagagatgtggcagagtactcagaggccaaggaagtccggggggtgaag
gtcttccgctcctcggccaccgtgtactttgccaatgctgagttctacagtgatgcgctg
aagcagaggtgtggtgtggatgtcgacttcctcatctcccagaagaagaaactgctcaag
aagcaggagcagctgaagctgaagcaactgcagaaagaggagaagcttcggaaacaggct
gcctcccccaagggcgcctcagtttccattaatgtcaacaccagccttgaagacatgagg
agcaacaacgttgaggactgcaagatgatgcaggtgagctcaggagataagatggaagat
gcaacagccaatggtcaagaagactccaaggccccagatgggtccacactgaaggccctg
ggcctgcctcagccagacttccacagcctcatcctggacctgggtgccctctcctttgtg
gacactgtgtgcctcaagagcctgaagaatattttccatgacttccgggagattgaggtg
gaggtgtacatggcggcctgccacagccctgtggtcagccagcttgaggctgggcacttc
ttcgatgcatccatcaccaagaagcatctctttgcctctgtccatgatgctgtcaccttt
gccctccaacacccgaggcctgtccccgacagccctgtttcggtcaccagactctga

DBGET integrated database retrieval system