KEGG   Homo sapiens (human): 65010Help
Entry
65010             CDS       T01001                                 

Gene name
SLC26A6
Definition
(RefSeq) solute carrier family 26 member 6
  KO
K14704  
solute carrier family 26 (sulfate anion transporter), member 6
Organism
hsa  Homo sapiens (human)
Pathway
Mineral absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04978 Mineral absorption
    65010 (SLC26A6)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC26: Multifunctional anion exchanger
   65010 (SLC26A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.3
AA seq 759 aa AA seqDB search
MGLADASGPRDTQALLSATQAMDLRRRDYHMERPLLNQEHLEELGRWGSAPRTHQWRTWL
QCSRARAYALLLQHLPVLVWLPRYPVRDWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPV
FGLYSSFYPVFIYFLFGTSRHISVGTFAVMSVMVGSVTESLAPQALNDSMINETARDAAR
VQVASTLSVLVGLFQVGLGLIHFGFVVTYLSEPLVRGYTTAAAVQVFVSQLKYVFGLHLS
SHSGPLSLIYTVLEVCWKLPQSKVGTVVTAAVAGVVLVVVKLLNDKLQQQLPMPIPGELL
TLIGATGISYGMGLKHRFEVDVVGNIPAGLVPPVAPNTQLFSKLVGSAFTIAVVGFAIAI
SLGKIFALRHGYRVDSNQELVALGLSNLIGGIFQCFPVSCSMSRSLVQESTGGNSQVAGA
ISSLFILLIIVKLGELFHDLPKAVLAAIIIVNLKGMLRQLSDMRSLWKANRADLLIWLVT
FTATILLNLDLGLVVAVIFSLLLVVVRTQMPHYSVLGQVPDTDIYRDVAEYSEAKEVRGV
KVFRSSATVYFANAEFYSDALKQRCGVDVDFLISQKKKLLKKQEQLKLKQLQKEEKLRKQ
AASPKGASVSINVNTSLEDMRSNNVEDCKMMQVSSGDKMEDATANGQEDSKAPDGSTLKA
LGLPQPDFHSLILDLGALSFVDTVCLKSLKNIFHDFREIEVEVYMAACHSPVVSQLEAGH
FFDASITKKHLFASVHDAVTFALQHPRPVPDSPVSVTRL
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggggctggcggatgcgtcgggaccgagggacacacaggcactgctgtctgcaacacaa
gcaatggacctgcggaggcgagactaccacatggaacggccgctgctgaaccaggagcat
ttggaggagctggggcgctggggctcagcacctaggacccaccagtggcggacctggttg
cagtgctcccgtgctcgggcctatgcccttctgctccaacacctcccggttttggtctgg
ttaccccggtatcctgtgcgtgactggctcctgggtgacctgttatccggcctgagtgtg
gccatcatgcagcttccgcagggcttggcctacgccctcctggctggattgccccccgtg
tttggcctctatagctccttctaccctgtcttcatctacttcctgtttggcacttcccgg
cacatctccgtggggacctttgctgtcatgtctgtgatggtgggcagtgtgacagaatcc
ctggccccgcaggccttgaacgactccatgatcaatgagacagccagagatgctgcccgg
gtacaggtggcctccacactcagtgtcctggttggcctcttccaggtggggctgggcctg
atccacttcggcttcgtggtcacctacctgtcagaacctcttgtccgaggctataccaca
gctgcagctgtgcaggtcttcgtctcacagctcaagtatgtgtttggcctccatctgagc
agccactctgggccactgtccctcatctatacagtgctggaggtctgctggaagctgccc
cagagcaaggttggcaccgtggtcactgcagctgtggctggggtggtgctcgtggtggtg
aagctgttgaatgacaagctgcagcagcagctgcccatgccgatacccggggagctgctc
acgctcatcggggccacaggcatctcctatggcatgggtctaaagcacagatttgaggta
gatgtcgtgggcaacatccctgcagggctggtgcccccagtggcccccaacacccagctg
ttctcaaagctcgtgggcagcgccttcaccatcgctgtggttgggtttgccattgccatc
tcactggggaagatcttcgccctgaggcacggctaccgggtggacagcaaccaggagctg
gtggccctgggcctcagtaaccttatcggaggcatcttccagtgcttccccgtgagttgc
tctatgtctcggagcctggtacaggagagcaccgggggcaactcgcaggttgctggagcc
atctcttcccttttcatcctcctcatcattgtcaaacttggggaactcttccatgacctg
cccaaggcggtcctggcagccatcatcattgtgaacctgaagggcatgctgaggcagctc
agcgacatgcgctccctctggaaggccaatcgggcggatctgcttatctggctggtgacc
ttcacggccaccatcttgctgaacctggaccttggcttggtggttgcggtcatcttctcc
ctgctgctcgtggtggtccggacacagatgccccactactctgtcctggggcaggtgcca
gacacggatatttacagagatgtggcagagtactcagaggccaaggaagtccggggggtg
aaggtcttccgctcctcggccaccgtgtactttgccaatgctgagttctacagtgatgcg
ctgaagcagaggtgtggtgtggatgtcgacttcctcatctcccagaagaagaaactgctc
aagaagcaggagcagctgaagctgaagcaactgcagaaagaggagaagcttcggaaacag
gctgcctcccccaagggcgcctcagtttccattaatgtcaacaccagccttgaagacatg
aggagcaacaacgttgaggactgcaagatgatgcaggtgagctcaggagataagatggaa
gatgcaacagccaatggtcaagaagactccaaggccccagatgggtccacactgaaggcc
ctgggcctgcctcagccagacttccacagcctcatcctggacctgggtgccctctccttt
gtggacactgtgtgcctcaagagcctgaagaatattttccatgacttccgggagattgag
gtggaggtgtacatggcggcctgccacagccctgtggtcagccagcttgaggctgggcac
ttcttcgatgcatccatcaccaagaagcatctctttgcctctgtccatgatgctgtcacc
tttgccctccaacacccgaggcctgtccccgacagccctgtttcggtcaccagactctga

DBGET integrated database retrieval system