KEGG   Homo sapiens (human): 6504Help
Entry
6504              CDS       T01001                                 

Gene name
SLAMF1, CD150, CDw150, SLAM
Definition
signaling lymphocytic activation molecule family member 1
Orthology
K06536  
signaling lymphocytic activation molecule family member 1
Organism
hsa  Homo sapiens (human)
Pathway
Measles
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05162 Measles
    6504 (SLAMF1)
Cellular antigens [BR:hsa04090]
 Proteins
  6504 (SLAMF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
1q23.3
AA seq 335 aa AA seqDB search
MDPKGLLSLTFVLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSI
HIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLM
TLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKA
GTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPWAV
YAGLLGGVIMILIMVVILQLRRRGKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQ
DPCTTIYVAATEPVPESVQETNSITVYASVTLPES
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggatcccaaggggctcctctccttgaccttcgtgctgtttctctccctggcttttggg
gcaagctacggaacaggtgggcgcatgatgaactgcccaaagattctccggcagttggga
agcaaagtgctgctgcccctgacatatgaaaggataaataagagcatgaacaaaagcatc
cacattgtcgtcacaatggcaaaatcactggagaacagtgtcgagaacaaaatagtgtct
cttgatccatccgaagcaggccctccacgttatctaggagatcgctacaagttttatctg
gagaatctcaccctggggatacgggaaagcaggaaggaggatgagggatggtaccttatg
accctggagaaaaatgtttcagttcagcgcttttgcctgcagttgaggctttatgagcag
gtctccactccagaaattaaagttttaaacaagacccaggagaacgggacctgcaccttg
atactgggctgcacagtggagaagggggaccatgtggcttacagctggagtgaaaaggcg
ggcacccacccactgaacccagccaacagctcccacctcctgtccctcaccctcggcccc
cagcatgctgacaatatctacatctgcaccgtgagcaaccctatcagcaacaattcccag
accttcagcccgtggcccggatgcaggacagacccctcagaaacaaaaccatgggcagtg
tatgctgggctgttagggggtgtcatcatgattctcatcatggtggtaatactacagttg
agaagaagaggtaaaacgaaccattaccagacaacagtggaaaaaaaaagccttacgatc
tatgcccaagtccagaaaccaggtcctcttcagaagaaacttgactccttcccagctcag
gacccttgcaccaccatatatgttgctgccacagagcctgtcccagagtctgtccaggaa
acaaattccatcacagtctatgctagtgtgacacttccagagagctga

DBGET integrated database retrieval system