KEGG   Homo sapiens (human): 6505Help
Entry
6505              CDS       T01001                                 

Gene name
SLC1A1, EAAC1, EAAT3, SCZD18
Definition
solute carrier family 1 (neuronal/epithelial high affinity glutamate transporter, system Xag), member 1
Orthology
K05612  
solute carrier family 1 (neuronal/epithelial high affinity glutamate transporter), member 1
Organism
hsa  Homo sapiens (human)
Pathway
Glutamatergic synapse
Protein digestion and absorption
Disease
H00911  
Dicarboxylic aminoaciduria
Class
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:hsa04724]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9p24
AA seq 524 aa AA seqDB search
MGKPARKGCEWKRFLKNNWVLLSTVAAVVLGITTGVLVREHSNLSTLEKFYFAFPGEILM
RMLKLIILPLIISSMITGVAALDSNVSGKIGLRAVVYYFCTTLIAVILGIVLVVSIKPGV
TQKVGEIARTGSTPEVSTVDAMLDLIRNMFPENLVQACFQQYKTKREEVKPPSDPEMNMT
EESFTAVMTTAISKNKTKEYKIVGMYSDGINVLGLIVFCLVFGLVIGKMGEKGQILVDFF
NALSDATMKIVQIIMCYMPLGILFLIAGKIIEVEDWEIFRKLGLYMATVLTGLAIHSIVI
LPLIYFIVVRKNPFRFAMGMAQALLTALMISSSSATLPVTFRCAEENNQVDKRITRFVLP
VGATINMDGTALYEAVAAVFIAQLNDLDLGIGQIITISITATSASIGAAGVPQAGLVTMV
IVLSAVGLPAEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQMDVSSEVN
IVNPFALESTILDNEDSDTKKSYVNGGFAVDKSDTISFTQTSQF
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaccggcgaggaaaggatgcgagtggaagcgcttcctgaagaataactgggtg
ttgctgtccaccgtggccgcggtggtgctaggcattaccacaggagtcttggttcgagaa
cacagcaacctctcaactctagagaaattctactttgcttttcctggagaaattctaatg
cggatgctgaaactcatcattttgccattaattatatccagcatgattacaggtgttgct
gcactggattccaacgtatccggaaaaattggtctgcgcgctgtcgtgtattatttctgt
accactctcattgctgttattctaggtattgtgctggtggtgagcatcaagcctggtgtc
acccagaaagtgggtgaaattgcgaggacaggcagcacccctgaagtcagtacggtggat
gccatgttagatctcatcaggaatatgttccctgagaatcttgtccaggcctgttttcag
cagtacaaaactaagcgtgaagaagtgaagcctcccagcgatccagagatgaacatgaca
gaagagtccttcacagctgtcatgacaactgcaatttccaagaacaaaacaaaggaatac
aaaattgttggcatgtattcagatggcataaacgtcctgggcttgattgtcttttgcctt
gtctttggacttgtcattggaaaaatgggagaaaagggacaaattctggtggatttcttc
aatgctttgagtgatgcaaccatgaaaatcgttcagatcatcatgtgttatatgccacta
ggtattttgttcctgattgctgggaagatcatagaagttgaagactgggaaatattccgc
aagctgggcctttacatggccacagtcctgactgggcttgcaatccactccattgtaatt
ctcccgctgatatatttcatagtcgtacgaaagaaccctttccgatttgccatgggaatg
gcccaggctctcctgacagctctcatgatctcttccagttcagcaacactgcctgtcacc
ttccgctgtgctgaagaaaataaccaggtggacaagaggatcactcgattcgtgttaccc
gttggtgcaacaatcaacatggatgggactgcgctctatgaagcagtggcagcggtgttt
attgcacagttgaatgacctggacttgggcattgggcagatcatcaccatcagtatcacg
gccacatctgccagcatcggagctgctggcgtgccccaggctggcctggtgaccatggtg
attgtgctgagtgccgtgggcctgcccgccgaggatgtcaccctgatcattgctgtcgac
tggctcctggaccggttcaggaccatggtcaacgtccttggtgatgcttttgggacgggc
attgtggaaaagctctccaagaaggagctggagcagatggatgtttcatctgaagtcaac
attgtgaatccctttgccttggaatccacaatccttgacaacgaagactcagacaccaag
aagtcttatgtcaatggaggctttgcagtagacaagtctgacaccatctcattcacccag
acctcacagttctag

DBGET integrated database retrieval system