KEGG   Homo sapiens (human): 65059Help
Entry
65059             CDS       T01001                                 

Gene name
RAPH1, ALS2CR18, ALS2CR9, LPD, PREL-2, PREL2, RMO1, RalGDS/AF-6
Definition
(RefSeq) Ras association (RalGDS/AF-6) and pleckstrin homology domains 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q33
AA seq 1250 aa AA seqDB search
MEQLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDSDKPMEPVKRSPLRQET
NMANFSYRFSIYNLNEALNQGETVDLDALMADLCSIEQELSSIGSGNSKRQITETKATQK
LPVSRHTLKHGTLKGLSSSSNRIAKPSHASYSLDDVTAQLEQASLSMDEAAQQSVLEDTK
PLVTNQHRRTASAGTVSDAEVHSISNSSHSSITSAASSMDSLDIDKVTRPQELDLTHQGQ
PITEEEQAAKLKAEKIRVALEKIKEAQVKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNL
MDKSHCGYSLDWSLVETVSELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALF
KNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLL
RASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQDYRNKYKAPTDYCLVLKHPQIQKKSQ
YIKYLCCDDVRTLHQWVNGIRIAKYGKQLYMNYQEALKRTESAYDWTSLSSSSIKSGSSS
SSIPESQSNHSNQSDSGVSDTQPAGHVRSQSIVSSVFSEAWKRGTQLEESSKARMESMNR
PYTSLVPPLSPQPKIVTPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAPSAGSA
APMFVKYSTITRLQNASQHSGALFKPPTPPVMQSQSVKPQILVPPNGVVPPPPPPPPPPT
PGSAMAQLKPAPCAPSLPQFSAPPPPLKIHQVQHITQVAPPTPPPPPPIPAPLPPQAPPK
PLVTIPAPTSTKTVAPVVTQAAPPTPTPPVPPAKKQPAFPASYIPPSPPTPPVPVPPPTL
PKQQSFCAKPPPSPLSPVPSVVKQIASQFPPPPTPPAMESQPLKPVPANVAPQSPPAVKA
KPKWQPSSIPVPSPDFPPPPPESSLVFPPPPPSPVPAPPPPPPPTASPTPDKSGSPGKKT
SKTSSPGGKKPPPTPQRNSSIKSSSGAEHPEPKRPSVDSLVSKFTPPAESGSPSKETLPP
PAAPPKPGKLNLSGVNLPGVLQQGCVSAKAPVLSGRGKDSVVEFPSPPSDSDFPPPPPET
ELPLPPIEIPAVFSGNTSPKVAVVNPQPQQWSKMSVKKAPPPTRPKRNDSTRLTQAEISE
QPTMATVVPQVPTSPKSSLSVQPGFLADLNRTLQRKSITRHGSLSSRMSRAEPTATMDDM
ALPPPPPELLSDQQKAGYGGSHISGYATLRRGPPPAPPKRDQNTKLSRDW
NT seq 3753 nt NT seq  +upstreamnt  +downstreamnt
atggagcagctatcagatgaagaaattgatcatggtgctgaagaagacagtgacaaggaa
gatcaggacctggacaaaatgtttggagcctggcttggagaactagacaaactcactcag
agtttggattctgacaagcccatggaaccagtaaaaagatctcctcttcgccaggaaaca
aacatggccaacttttcttaccgcttctccatatacaacttgaatgaagctctgaatcag
ggagagactgtggatctggatgccttgatggctgatctttgctctatagagcaggagctc
agcagcattggttcaggaaacagtaagcgtcaaatcacagaaacgaaagctactcagaaa
ttgcctgttagccgacatacattgaaacatggcaccttgaaaggattatcttcttcatct
aataggatagctaaaccttcccatgccagctactccttggacgacgtcactgcacagtta
gaacaggcctctttgagtatggatgaggctgctcagcaatctgtactagaagatactaaa
cccttagtaactaatcagcacagaagaaccgcgtcagcaggcacagtgagtgatgctgaa
gtacactctattagtaattcctcccattccagcatcacttccgcagcctccagcatggac
tctttggatattgataaagtaacacgccctcaagagctggatttgacacatcaagggcag
ccaattactgaggaagaacaggcagcaaaattgaaagctgagaagatcagagttgcccta
gagaaaattaaagaggcacaagtgaaaaagctggtgatcagagtccacatgtctgatgac
agttctaaaacaatgatggtggatgagaggcagacagtaagacaagtactggataacctg
atggacaaatcccactgcggttatagtttagactggtcactggtagaaaccgtttctgaa
ttacaaatggagagaatctttgaagaccatgaaaacttggttgaaaatcttcttaattgg
acaagagatagccaaaacaagcttatatttatggagcgtatagaaaaatatgcacttttc
aaaaacccacagaattatcttttggggaaaaaagaaacagctgagatggcagatagaaac
aaagaagtcctcttggaggaatgtttttgtggaagttctgtaactgtaccagaaattgaa
ggagtcctttggttgaaggatgatggcaagaagtcctggaaaaagcgttattttctcttg
cgagcatctggtatctactatgttcccaaaggaaaagcaaaggtctctcgggatctggtg
tgctttctccagctggatcatgtcaacgtttattatggccaggactatcggaacaaatac
aaagcacctacagactattgtctggtgctgaagcatccacaaatccagaagaaatctcaa
tatatcaaatacctttgttgtgatgatgtgaggacactgcatcagtgggtcaatgggatc
cgcattgcaaagtatgggaagcagctctatatgaactaccaagaagccttgaagaggaca
gagtcagcctatgattggacttccttatccagctccagcattaaatcgggatccagttct
tccagcatcccagagtctcagtcaaaccactccaatcagtctgatagcggagtttctgac
acccagccagcaggacacgtccgttcccagagcattgtgagctccgtattctctgaagcc
tggaaacgaggcactcagttggaagagtccagcaaggccagaatggagtctatgaatcgg
ccctacacttcacttgtgccccctttatccccgcaacctaagatagtcaccccctacact
gcttcacagccttcaccacctctacctcctccgccacccccacctcctcctccaccaccc
cctccaccaccccctcctcccccactccccagccagtctgcaccttctgcaggctcagca
gccccaatgttcgtcaagtacagcacaataacacggctacagaatgcgtctcagcattca
ggggccctgtttaagccgccaacacccccagtgatgcagtcacagtcagtgaagcctcag
atcctggtaccccccaatggagttgttccaccaccccctccccctcctccacccccaacc
ccaggctctgccatggcccagctaaagcctgcaccgtgtgccccatcccttccacagttc
agtgccccgcctcctccactgaagatccatcaagttcagcatattactcaggtggctccc
ccaacaccccccccacctcctcctatccctgcacccctccctccccaagctcccccaaaa
ccccttgtgaccatccccgcaccaaccagcaccaagactgtggcacctgttgtgactcaa
gctgcaccacccacacctactcctccagtgcccccagcaaaaaagcagccagctttccct
gcttcttacattccaccctctccccctacccctcctgttccagtacccccgccaacatta
cccaagcaacagagcttctgtgcaaaaccccctccctctccactgtcaccggtgccctcg
gtcgtgaagcagatagccagccagtttccaccccctccaactccccctgccatggaatct
cagcccttaaagcctgtcccagcaaatgtagctccacagtcccctcctgcagtaaaagca
aagcccaagtggcagcccagctccatcccagtcccttctccggacttccctcctccccct
cctgaaagcagcctggtgtttcctcctccacccccatcacctgtcccagccccaccacca
ccacctccacccacagcttctcctacccctgacaaaagtggatctccaggcaaaaagacc
agtaagacgtccagccctgggggaaagaaaccacccccaaccccacagcgcaactccagc
attaaatccagcagtggtgcagagcaccccgagcccaagagaccctcggtggacagtcta
gtcagcaagtttacaccgccagcagaatcagggtctcccagcaaggagaccctaccacct
cctgcagcaccccccaagcctggaaaactcaatctttctggagtcaaccttcctggagtt
ctccaacaagggtgtgtgtcagcaaaagcccctgttctgagtgggcgtggaaaggactcc
gtggtggaatttccttctcctccatccgattctgattttccaccccctccacctgaaaca
gagcttcctctgccccccattgagattccagcagttttctcgggaaacacctctccaaaa
gtggcagtcgttaatcctcaaccacaacaatggtctaaaatgtcagtgaagaaggcccct
ccacccacacgacccaaacggaatgatagcacccgcctcactcaagctgagatttctgag
cagccaacaatggccacagttgtgccacaagtgcccacctctcccaaatccagccttagt
gtccagcctggattcctggctgacctcaacaggacactgcaacgaaagtccatcactcgg
cacggctcactctcctcccgcatgtccagagcagaaccaacagccaccatggatgatatg
gcattgcctccaccaccccctgaactgctgtctgatcaacagaaggctggttacggaggc
agtcatatatcaggctatgcaacgttgcggagaggaccccctcctgctccccccaaaaga
gaccagaacaccaagctctccagagactggtag

DBGET integrated database retrieval system