KEGG   Homo sapiens (human): 65083Help
Entry
65083             CDS       T01001                                 

Gene name
NOL6, NRAP, UTP22, bA311H10.1
Definition
nucleolar protein 6 (RNA-associated)
Orthology
K14544  
U3 small nucleolar RNA-associated protein 22
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    65083 (NOL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9p13.3
AA seq 1146 aa AA seqDB search
MGPAPAGEQLRGATGEPEVMEPALEGTGKEGKKASSRKRTLAEPPAKGLLQPVKLSRAEL
YKEPTNEELNRLRETEILFHSSLLRLQVEELLKEVRLSEKKKDRIDAFLREVNQRVVRVP
SVPETELTDQAWLPAGVRVPLHQVPYAVKGCFRFLPPAQVTVVGSYLLGTCIRPDINVDV
ALTMPREILQDKDGLNQRYFRKRALYLAHLAHHLAQDPLFGSVCFSYTNGCHLKPSLLLR
PRGKDERLVTVRLHPCPPPDFFRPCRLLPTKNNVRSAWYRGQSPAGDGSPEPPTPRYNTW
VLQDTVLESHLQLLSTILSSAQGLKDGVALLKVWLRQRELDKGQGGFTGFLVSMLVVFLV
STRKIHTTMSGYQVLRSVLQFLATTDLTVNGISLCLSSDPSLPALADFHQAFSVVFLDSS
GHLNLCADVTASTYHQVQHEARLSMMLLDSRADDGFHLLLMTPKPMIRAFDHVLHLRPLS
RLQAACHRLKLWPELQDNGGDYVSAALGPLTTLLEQGLGARLNLLAHSRPPVPEWDISQD
PPKHKDSGTLTLGLLLRPEGLTSVLELGPEADQPEAAKFRQFWGSRSELRRFQDGAIREA
VVWEAASMSQKRLIPHQVVTHLLALHADIPETCVHYVGGPLDALIQGLKETSSTGEEALV
AAVRCYDDLSRLLWGLEGLPLTVSAVQGAHPVLRYTEVFPPTPVRPAFSFYETLRERSSL
LPRLDKPCPAYVEPMTVVCHLEGSGQWPQDAEAVQRVRAAFQLRLAELLTQQHGLQCRAT
ATHTDVLKDGFVFRIRVAYQREPQILKEVQSPEGMISLRDTAASLRLERDTRQLPLLTSA
LHGLQQQHPAFSGVARLAKRWVRAQLLGEGFADESLDLVAAALFLHPEPFTPPSSPQVGF
LRFLFLVSTFDWKNNPLFVNLNNELTVEEQVEIRSGFLAARAQLPVMVIVTPQDRKNSVW
TQDGPSAQILQQLVVLAAEALPMLEKQLMDPRGPGDIRTVFRPPLDIYDVLIRLSPRHIP
RHRQAVDSPAASFCRGLLSQPGPSSLMPVLGYDPPQLYLTQLREAFGDLALFFYDQHGGE
VIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLGEGLVQTVEAR
SERWTV
NT seq 3441 nt NT seq  +upstreamnt  +downstreamnt
atggggccggcgccagctggagagcagcttcgcggagcgactggagagccagaggtgatg
gaaccagccctggaaggcacaggcaaagaggggaagaaagcatcctccaggaagcgtaca
ttggctgaacctccagcgaagggcctcctgcagccagtgaagctcagcagggcagaactg
tacaaggagcctaccaatgaggagcttaatcgccttcgggagactgagatcttgttccac
tccagcttgcttcgtttacaggtagaggagctactaaaggaagtaaggctgtcagagaag
aagaaggatcggattgatgccttcctacgggaggtcaaccagcgggttgtgagggtgccc
tcagtccctgagacagagctcactgaccaggcatggctcccagctggggttcgagtgccc
ctccaccaagtgccctatgccgtgaagggctgtttccgcttcctgcccccagcccaggtt
actgttgtgggcagctaccttctgggcacctgcatccgaccagacatcaatgtggatgtg
gcactgaccatgcccagggaaatcctacaggacaaggacgggctgaaccagcgctacttc
cgcaagcgtgccctctacctggcccacttggctcaccacctggcccaggaccccctcttt
ggcagtgtttgcttctcctacacaaatggctgccacctgaaaccctcactgttgctgcgg
ccgcgtggaaaggatgagcgcctggtcactgtacgtctgcatccgtgccctccacctgac
ttcttccgcccgtgccgcttgctgccaaccaagaacaatgtgcgctctgcctggtaccga
gggcagagtcctgcaggggatggtagcccagagcctcctaccccccgctataacacatgg
gtcctgcaagatacagttctcgagtcccatttgcagctgctgtcaaccattctgagttca
gcccagggcctgaaggatggcgtggcacttctgaaggtctggctgcggcagcgggagctg
gacaagggccagggtgggtttactgggttccttgtctccatgctggttgtcttccttgtg
tctacacgcaagatccataccaccatgagtggctaccaggtcctgagaagtgtcttgcag
tttctggccactacagacctgacagtcaacgggatcagtttatgtctcagctcagatccc
tctttgccggccctggctgacttccaccaggccttctccgttgtcttcctggattcctca
ggccatctcaacctctgtgctgatgtcactgcctctacttaccaccaggtacagcatgag
gcacggctgtctatgatgttgctggacagcagagctgacgacgggttccacctgctgttg
atgactcccaaacccatgatccgggcttttgaccatgtcctgcatctccgtccactgagt
cgcctgcaggcagcgtgccaccggctgaagctctggccagagctgcaggacaatggtggg
gactatgtctcagctgctttgggccccctgaccaccctcctggagcagggcctgggggct
cggctgaacctgctggctcactctcgacccccagtcccagagtgggacatcagccaagat
ccaccaaagcacaaagactctgggaccctgaccctgggactccttctccggcctgaggga
ctgaccagcgtccttgagctgggtccagaggcagaccagcctgaggctgctaaattccgc
cagttctggggatcccgctcggagcttcggcgtttccaggacggagccattcgggaagct
gtggtctgggaggcagcctctatgtcccagaagcgccttattccccaccaggtggtcacc
cacctcttggcactccatgctgacatcccagaaacctgtgtccactatgtggggggcccc
ctggatgcacttatccaaggcctgaaagagacctccagcacaggtgaggaggccctggta
gcggcggtacgttgctacgacgacctcagtcgcctactgtgggggctagagggtctccca
ctgaccgtgtctgctgttcagggagctcacccagtgctgcgctacacagaggtgttccca
ccaactccagtccgtccagccttctccttctatgagactctgcgggagcggtcctcactg
ctgccccggctcgataagccctgtccggcctacgtggagcccatgaccgtggtttgtcac
ctggagggcagtggccagtggccacaggacgctgaggccgtgcagcgggtccgagctgcc
ttccagctgcgcctggcagagctgttgacacaacagcatggtctgcagtgccgtgccact
gccacgcacacggatgtccttaaggatggatttgtgtttcggattcgcgtggcctatcag
cgggagccccagatcctgaaggaggtgcagagcccagaggggatgatctcgctgagggac
acagctgcctccctccgccttgagagagacacaaggcagttgccactgctcaccagtgcc
ctgcacggactgcagcagcagcacccagccttctctggtgtggcacggctggccaagcgg
tgggtgcgtgcccagcttcttggtgagggtttcgctgatgagagcctggatctggtggcc
gctgcccttttcctgcaccctgagcccttcacccctccgagttccccccaggttggcttc
cttcgattccttttcttggtatcaacgtttgattggaagaacaaccccctctttgtcaac
ctcaataatgagctcactgtggaggagcaggtggagatccgcagtggcttcctggcagct
cgggcacagctccccgtcatggtcattgttaccccccaagaccgcaaaaactctgtgtgg
acacaggatggaccctcagcccagatcctgcagcagcttgtggtcctggcagctgaagcc
ctgcccatgttagagaagcagctcatggatccccggggacctggggacatcaggacagtg
ttccggccgcccttggacatttacgacgtgctgattcgcctgtctcctcgccatatcccg
cggcaccgccaggctgtggactcgccagctgcctccttctgccggggcctgctcagccag
ccggggccctcatccctgatgcccgtgctgggctatgatcctcctcagctctatctgacg
cagctcagggaggcctttggggatctggcccttttcttctatgaccagcatggtggagag
gtgattggtgtcctctggaagcccaccagcttccagccgcagcccttcaaggcctccagc
acaaaggggcgcatggtgatgtctcgaggtggggagctagtaatggtgcccaatgttgaa
gcaatcctggaggactttgctgtgctgggtgaaggcctggtgcagactgtggaggcccga
agtgagaggtggactgtgtga

DBGET integrated database retrieval system