KEGG   Homo sapiens (human): 65108Help
Entry
65108             CDS       T01001                                 

Gene name
MARCKSL1, F52, MACMARCKS, MLP, MLP1, MRP
Definition
MARCKS-like 1
Orthology
K13536  
MARCKS-related protein
Organism
hsa  Homo sapiens (human)
Pathway
Fc gamma R-mediated phagocytosis
Leishmaniasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    65108 (MARCKSL1)
 Human Diseases
  Infectious diseases
   05140 Leishmaniasis
    65108 (MARCKSL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p35.1
AA seq 195 aa AA seqDB search
MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGA
TGDAIEPAPPSQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASS
PTEEEQEQGEIGACSDEGTAQEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPS
GPESGPTPASAEQNE
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgggcagccagagctccaaggctccccggggcgacgtgaccgccgaggaggcagcaggc
gcttcccccgcgaaggccaacggccaggagaatggccacgtgaaaagcaatggagactta
tcccccaagggtgaaggggagtcgccccctgtgaacggaacagatgaggcagccggggcc
actggcgatgccatcgagccagcaccccctagccagggtgctgaggccaagggggaggtc
ccccccaaggagacccccaagaagaagaagaaattctctttcaagaagcctttcaaattg
agcggcctgtccttcaagagaaatcggaaggagggtgggggtgattcttctgcctcctca
cccacagaggaagagcaggagcagggggagatcggtgcctgcagcgacgagggcactgct
caggaagggaaggccgcagccacccctgagagccaggaaccccaggccaagggggcagag
gctagtgcagcctcagaagaagaggcagggccccaggctacagagccatccactccctcg
gggccggagagtggccctacaccagccagcgctgagcagaatgagtag

DBGET integrated database retrieval system