KEGG   Homo sapiens (human): 65109Help
Entry
65109             CDS       T01001                                 

Gene name
UPF3B, HUPF3B, MRX62, MRXS14, RENT3B, UPF3BP1, UPF3BP2, UPF3BP3, UPF3X, Upf3p-X
Definition
(RefSeq) UPF3B, regulator of nonsense mediated mRNA decay
  KO
K14328  
regulator of nonsense transcripts 3
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
mRNA surveillance pathway
Module
Exon junction complex (EJC)
Disease
H00658  
Syndromic X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    65109 (UPF3B)
   03015 mRNA surveillance pathway
    65109 (UPF3B)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     65109 (UPF3B)
   mRNA cycle factors
    P-body specific factors
     65109 (UPF3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9BZI7(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
Xq24
AA seq 483 aa AA seqDB search
MKEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKGEDKQDRNKEKKEALSKVVIRRLPP
TLTKEQLQEHLQPMPEHDYFEFFSNDTSLYPHMYARAYINFKNQEDIILFRDRFDGYVFL
DNKGQEYPAIVEFAPFQKAAKKKTKKRDTKVGTIDDDPEYRKFLESYATDNEKMTSTPET
LLEEIEAKNRELIAKKTTPLLSFLKNKQRMREEKREERRRREIERKRQREEERRKWKEEE
KRKRKDIEKLKKIDRIPERDKLKDEPKIKVHRFLLQAVNQKNLLKKPEKGDEKELDKREK
AKKLDKENLSDERASGQSCTLPKRSDSELKDEKPKRPEDESGRDYREREREYERDQERIL
RERERLKRQEEERRRQKERYEKEKTFKRKEEEMKKEKDTLRDKGKKAESTESIGSSEKTE
KKEEVVKRDRIRNKDRPAMQLYQPGARSRNRLCPPDDSTKSGDSAAERKQESGISHRKEG
GEE
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaagagaaggagcacaggcctaaggagaagcgagtaaccctgttaacccccgcc
ggggccacaggcagcggtggtgggacctcgggggacagctccaagggggaagataagcag
gatcgcaacaaggagaagaaagaagcgctgagcaaggtggtaattcgaagattacctccc
actttgaccaaggagcagcttcaggaacatcttcaacctatgcctgagcatgattatttt
gagtttttttctaatgatacgagtttgtatcctcatatgtatgccagagcatacatcaac
tttaaaaaccaagaggacattattttgttcagggatcgctttgatggttatgtattcctt
gacaataaaggtcaggaatatcccgctatagtagaatttgcaccttttcaaaaagctgca
aaaaagaagactaagaaaagagataccaaagtcgggactatcgatgatgatccagaatat
agaaagtttttggaaagttatgccacagataatgagaaaatgacatctactccagagaca
ctgctagaggaaatagaagcaaaaaatagagaattaatagctaaaaagacaaccccactt
ttgagcttcctgaaaaacaagcagagaatgagagaagaaaagagagaagaaaggaggagg
agagaaatagaaagaaaaagacaaagagaagaagagaggaggaaatggaaagaagaagag
aaacgaaaaaggaaagatatagaaaagctaaagaagatagacagaattccagaaagggac
aaattaaaggatgaaccaaagattaaggtacacaggtttctgttacaagctgtgaatcag
aaaaatctgctcaagaagccagaaaaaggagatgaaaaagaattggacaaaagagaaaaa
gccaagaaattggacaaagagaatctcagtgatgaaagagccagtgggcaaagttgtaca
ttgcccaagcgttctgatagcgaacttaaagatgaaaaaccaaagagacctgaagatgag
agcggcagagactatagggagagggaacgggaatatgaacgagatcaggagcgcatactt
cgagaaagagagaggctgaagcggcaagaagaagagcgccgtaggcagaaggagcgctat
gagaaagagaagacttttaagagaaaagaagaagaaatgaaaaaagagaaagacacactt
cgggataaaggaaagaaggctgaaagtacagaatcaataggcagctcagaaaaaactgaa
aagaaagaagaagtggtcaagagagatcgaataagaaacaaggatcgtccagcgatgcag
ctttaccaaccaggagctcgaagccgaaatcgactctgtccccctgatgacagcaccaag
tctggagattcagcagcagaaaggaagcaggaaagtggtattagccatagaaaagaagga
ggagaggagtga

DBGET integrated database retrieval system