KEGG   Homo sapiens (human): 6511Help
Entry
6511              CDS       T01001                                 

Gene name
SLC1A6, EAAT4
Definition
solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6
Orthology
K05617  
solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6
Organism
hsa  Homo sapiens (human)
Pathway
Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    6511 (SLC1A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.12
AA seq 312 aa AA seqDB search
MSSHGNSLFLRESGQRLGRVGWLQRLQESLQQRALRTRLRLQTMTLEHVLRFLRRNAFIL
LTVSAVVIGVSLAFALRPYQLTYRQIKYFSFPGELLMRMLQMLVLPLIVSSLVTGMASLD
NKATGRMGMRAAVYYMVTTIIAVFIGILMVTIIHPGKGSKEGLHREGRIETIPTADAFMD
LIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENV
TRALGTLQEMLSFEETVPVPGSANGINALGLVVFSVAFGLVIGGMKHKGRVLRDFFDSLN
EAIMRLVGIIIW
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccatggcaacagcctgttcctgcgggagagcggccagcggctgggccgggtg
ggctggctgcagcggctgcaggaaagcctgcagcagagagcactgcgcacgcgcctgcgc
ctgcagaccatgaccctcgagcacgtgctgcgcttcctgcgccgaaacgccttcattctg
ctgacggtcagcgccgtggtcattggggtcagcctggcctttgccctgcgcccatatcag
ctcacctaccgccagatcaagtacttctcttttcctggagagcttctgatgaggatgctg
cagatgctggtgttacctctcattgtctccagcctggtcacaggtatggcatccctggac
aacaaggccacggggcggatggggatgcgggcagctgtgtactacatggtgaccaccatc
atcgcggtcttcatcggcatcctcatggtcaccatcatccatcccgggaagggctccaag
gaggggctgcaccgggagggccggatcgagaccatccccacagctgatgccttcatggac
ctgatcagaaatatgtttccaccaaaccttgtggaggcctgcttcaaacagttcaagacg
cagtacagcacgagggtggtaaccaggaccatggtgaggacagagaacgggtctgagccg
ggtgcctccatgcctcctccattctcagtggagaacggaaccagcttcctggaaaatgtc
actcgggccttgggtaccctgcaggagatgctgagctttgaggagactgtacccgtgcct
ggctccgccaatggcatcaacgccctgggcctcgtggtcttctctgtggcctttgggctg
gtcattggtggcatgaaacacaagggcagagtcctcagggacttcttcgacagcctcaat
gaggctattatgaggctggtgggcatcattatctggtga

DBGET integrated database retrieval system