KEGG   Homo sapiens (human): 65110Help
Entry
65110             CDS       T01001                                 

Gene name
UPF3A, HUPF3A, RENT3A, UPF3
Definition
UPF3 regulator of nonsense transcripts homolog A (yeast)
Orthology
K14328  
regulator of nonsense transcripts 3
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
mRNA surveillance pathway
Module
Exon junction complex (EJC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    65110 (UPF3A)
   03015 mRNA surveillance pathway
    65110 (UPF3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q34
AA seq 476 aa AA seqDB search
MRSEKEGAGGLRAAVAARGPSGREKLSALEVQFHRDSQQQEAETPPTSSSGCGGGAGKPR
EEKRTALSKVVIRRLPPGLTKEQLEEQLRPLPAHDYFEFFAADLSLYPHLYSRAYINFRN
PDDILLFRDRFDGYIFLDSKGLEYPAVVEFAPFQKIAKKKLRKKDAKTGSIEDDPEYKKF
LETYCVEEEKTSANPETLLGEMEAKTRELIARRTTPLLEYIKNRKLEKQRIREEKREERR
RRELEKKRLREEEKRRRREEERCKKKETDKQKKIAEKEVRIKLLKKPEKGEEPTTEKPKE
RGEEIDTGGGKQESCAPGAVVKARPMEGSLEEPQETSHSGSDKEHRDVERSQEQESEAQR
YHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPGEAMERLGRAQRC
DDSPAPRKERLANKDRPALQLYDPGARFRARECGGNRRICKAEGSGTGPEKREEAE
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcggaaaaggagggggccggaggccttcgggcggccgttgccgcgcggggcccg
agcgggagggagaagctgtcggccctagaagtgcagttccaccgcgactcgcagcagcag
gaggctgagacgccgccaacttcgtcctccggttgcgggggcggtgcgggcaaacctcgc
gaggagaagaggacggccctgagcaaggtggtcatccgccgcctgcctccgggcctcacc
aaggagcagctggaggagcagctgcgcccgctgccagcacacgactacttcgagttcttc
gccgccgacctgagtctttatcctcatctctactcaagagcatacattaattttaggaat
cctgatgacatccttctttttagagatcgttttgatggatatatcttccttgacagcaaa
ggcctagaatatcctgcagtggtagagtttgctccattccagaagatagccaaaaagaag
ctgagaaaaaaagatgccaagactggaagcatcgaagatgatccagaatataagaagttt
ttagaaacctactgtgtggaggaagagaagaccagtgccaaccctgagactctgctgggg
gagatggaggcgaagacaagagagctcattgctagaagaaccacacctcttttggaatat
attaaaaatagaaaattagaaaagcagagaattcgagaagagaagcgagaagaacggagg
aggagagagttagaaaagaaacgtttgcgggaagaggaaaaaagaagaagaagagaagaa
gaaagatgcaaaaaaaaagagacagataaacagaagaaaattgcagagaaagaagtaagg
attaagcttcttaagaaaccagaaaagggagaggaaccaaccacagagaaaccaaaagaa
agaggagaggagattgatactggaggtggcaagcaggaatcctgtgcccccggtgcagtc
gtaaaagccaggcccatggaaggctcgctggaggagccccaggagacgtcacacagcggc
agtgataaagagcacagggatgtggagagatctcaagaacaagaatctgaagcacaaaga
taccatgtggatgacggcaggaggcacagagctcaccacgagcctgaacggctttccaga
aggagtgaggatgagcagagatgggggaaaggacctggccaagacagagggaagaagggg
agccaggacagcggggctccgggggaggccatggagagactgggaagagcgcagaggtgt
gacgacagtccagcacccagaaaagagcgactggcaaacaaggaccggccagccttgcag
ctgtatgatccaggagctcgcttccgagcgcgagagtgtggcggaaacaggaggatctgc
aaggcagaaggttcggggactggtcctgagaagagggaagaggcagagtga

DBGET integrated database retrieval system