KEGG   Homo sapiens (human): 6513Help
Entry
6513              CDS       T01001                                 

Gene name
SLC2A1, DYT17, DYT18, DYT9, EIG12, GLUT, GLUT1, GLUT1DS, HTLVR, PED
Definition
solute carrier family 2 (facilitated glucose transporter), member 1
Orthology
K07299  
MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
Insulin secretion
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Bile secretion
HTLV-I infection
Pathways in cancer
Renal cell carcinoma
Disease
H00831  
Primary dystonia
H00836  
GLUT1 deficiency syndrome (GLUT1DS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    6513 (SLC2A1)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    6513 (SLC2A1)
   04920 Adipocytokine signaling pathway
    6513 (SLC2A1)
   04919 Thyroid hormone signaling pathway
    6513 (SLC2A1)
  Digestive system
   04976 Bile secretion
    6513 (SLC2A1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    6513 (SLC2A1)
   05211 Renal cell carcinoma
    6513 (SLC2A1)
  Infectious diseases
   05166 HTLV-I infection
    6513 (SLC2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p34.2
AA seq 492 aa AA seqDB search
MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWVHRYGESILPTT
LTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFE
MLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIM
GNKDLWPLLLSIIFIPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHD
LQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEK
AGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAILMTIALALLEQ
LPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPE
ELFHPLGADSQV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggagcccagcagcaagaagctgacgggtcgcctcatgctggccgtgggaggagcagtg
cttggctccctgcagtttggctacaacactggagtcatcaatgccccccagaaggtgatc
gaggagttctacaaccagacatgggtccaccgctatggggagagcatcctgcccaccacg
ctcaccacgctctggtccctctcagtggccatcttttctgttgggggcatgattggctcc
ttctctgtgggccttttcgttaaccgctttggccggcggaattcaatgctgatgatgaac
ctgctggccttcgtgtccgccgtgctcatgggcttctcgaaactgggcaagtcctttgag
atgctgatcctgggccgcttcatcatcggtgtgtactgcggcctgaccacaggcttcgtg
cccatgtatgtgggtgaagtgtcacccacagcccttcgtggggccctgggcaccctgcac
cagctgggcatcgtcgtcggcatcctcatcgcccaggtgttcggcctggactccatcatg
ggcaacaaggacctgtggcccctgctgctgagcatcatcttcatcccggccctgctgcag
tgcatcgtgctgcccttctgccccgagagtccccgcttcctgctcatcaaccgcaacgag
gagaaccgggccaagagtgtgctaaagaagctgcgcgggacagctgacgtgacccatgac
ctgcaggagatgaaggaagagagtcggcagatgatgcgggagaagaaggtcaccatcctg
gagctgttccgctcccccgcctaccgccagcccatcctcatcgctgtggtgctgcagctg
tcccagcagctgtctggcatcaacgctgtcttctattactccacgagcatcttcgagaag
gcgggggtgcagcagcctgtgtatgccaccattggctccggtatcgtcaacacggccttc
actgtcgtgtcgctgtttgtggtggagcgagcaggccggcggaccctgcacctcataggc
ctcgctggcatggcgggttgtgccatactcatgaccatcgcgctagcactgctggagcag
ctaccctggatgtcctatctgagcatcgtggccatctttggctttgtggccttctttgaa
gtgggtcctggccccatcccatggttcatcgtggctgaactcttcagccagggtccacgt
ccagctgccattgccgttgcaggcttctccaactggacctcaaatttcattgtgggcatg
tgcttccagtatgtggagcaactgtgtggtccctacgtcttcatcatcttcactgtgctc
ctggttctgttcttcatcttcacctacttcaaagttcctgagactaaaggccggaccttc
gatgagatcgcttccggcttccggcaggggggagccagccaaagtgacaagacacccgag
gagctgttccatcccctgggggctgattcccaagtgtga

DBGET integrated database retrieval system