KEGG   Homo sapiens (human): 6515Help
Entry
6515              CDS       T01001                                 

Gene name
SLC2A3, GLUT3
Definition
(RefSeq) solute carrier family 2 member 3
  KO
K08142  
MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 3
Organism
hsa  Homo sapiens (human)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC2: Facilitative GLUT transporter
   6515 (SLC2A3)
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    6515 (SLC2A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13.3
AA seq 496 aa AA seqDB search
MGTQKVTPALIFAITVATIGSFQFGYNTGVINAPEKIIKEFINKTLTDKGNAPPSEVLLT
SLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKVAKSVEML
ILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVVGILVAQIFGLEFILGS
EELWPLLLGFTILPAILQSAALPFCPESPRFLLINRKEEENAKQILQRLWGTQDVSQDIQ
EMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAG
VQEPIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKDNYN
GMSFVCIGAILVFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLF
PSAAHYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFEGQAHGADRSGKDGV
MEMNSIEPAKETTTNV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggggacacagaaggtcaccccagctctgatatttgccatcacagttgctacaatcggc
tctttccaatttggctacaacactggggtcatcaatgctcctgagaagatcataaaggaa
tttatcaataaaactttgacggacaagggaaatgccccaccctctgaggtgctgctcacg
tctctctggtccttgtctgtggccatattttccgtcgggggtatgatcggctccttttcc
gtcggactcttcgtcaaccgctttggcaggcgcaattcaatgctgattgtcaacctgttg
gctgtcactggtggctgctttatgggactgtgtaaagtagctaagtcggttgaaatgctg
atcctgggtcgcttggttattggcctcttctgcggactctgcacaggttttgtgcccatg
tacattggagagatctcgcctactgccctgcggggtgcctttggcactctcaaccagctg
ggcatcgttgttggaattctggtggcccagatctttggtctggaattcatccttgggtct
gaagagctatggccgctgctactgggttttaccatccttcctgctatcctacaaagtgca
gcccttccattttgccctgaaagtcccagatttttgctcattaacagaaaagaagaggag
aatgctaagcagatcctccagcggttgtggggcacccaggatgtatcccaagacatccag
gagatgaaagatgagagtgcaaggatgtcacaagaaaagcaagtcaccgtgctagagctc
tttagagtgtccagctaccgacagcccatcatcatttccattgtgctccagctctctcag
cagctctctgggatcaatgctgtgttctattactcaacaggaatcttcaaggatgcaggt
gttcaagagcccatctatgccaccatcggcgcgggtgtggttaatactatcttcactgta
gtttctctatttctggtggaaagggcaggaagaaggactctgcatatgataggccttgga
gggatggctttttgttccacgctcatgactgtttctttgttattaaaggataactataat
gggatgagctttgtctgtattggggctatcttggtctttgtagccttctttgaaattgga
ccaggccccattccctggtttattgtggccgaactcttcagccagggcccccgcccagct
gcgatggcagtggccggctgctccaactggacctccaacttcctagtcggattgctcttc
ccctccgctgctcactatttaggagcctacgtttttattatcttcaccggcttcctcatt
accttcttggcttttaccttcttcaaagtccctgagacccgtggcaggacttttgaggat
atcacacgggcctttgaagggcaggcacacggtgcagatagatctggaaaggacggcgtc
atggagatgaacagcatcgagcctgctaaggagaccaccaccaatgtctaa

DBGET integrated database retrieval system