KEGG   Homo sapiens (human): 6517Help
Entry
6517              CDS       T01001                                 

Gene name
SLC2A4, GLUT4
Definition
solute carrier family 2 (facilitated glucose transporter), member 4
Orthology
K07191  
MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 4
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hsa04068]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:hsa04920]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:hsa04930]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13
AA seq 509 aa AA seqDB search
MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETW
LGRQGPEGPSSIPPGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAV
LGGSLMGLANAAASYEMLILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAI
VIGILIAQVLGLESLLGTASLWPLLLGLTVLPALLQLVLLPFCPESPRYLYIIQNLEGPA
RKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLSQQL
SGINAVFYYSTSIFETAGVGQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGM
CGCAILMTVALLLLERVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAM
AVAGFSNWTSNFIIGMGFQYVAEAMGPYVFLLFAVLLLGFFIFTFLRVPETRGRTFDQIS
AAFHRTPSLLEQEVKPSTELEYLGPDEND
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgggcttccaacagataggctccgaagatggggaaccccctcagcagcgagtg
actgggaccctggtccttgctgtgttctctgcggtgcttggctccctgcagtttgggtac
aacattggggtcatcaatgcccctcagaaggtgattgaacagagctacaatgagacgtgg
ctggggaggcaggggcctgagggacccagctccatccctccaggcaccctcaccaccctc
tgggccctctccgtggccatcttttccgtgggcggcatgatttcctccttcctcattggt
atcatctctcagtggcttggaaggaaaagggccatgctggtcaacaatgtcctggcggtg
ctggggggcagcctcatgggcctggccaatgctgctgcctcctatgaaatgctcatcctt
ggacgattcctcattggcgcctactcagggctgacatcagggctggtgcccatgtacgtg
ggggagattgctcccactcacctgcggggcgccctggggacgctcaaccaactggccatt
gttatcggcattctgatcgcccaggtgctgggcttggagtccctcctgggcactgccagc
ctgtggccactgctcctgggcctcacagtgctacctgccctcctgcagctggtcctgctg
cccttctgtcccgagagcccccgctacctctacatcatccagaatctcgaggggcctgcc
agaaagagtctgaagcgcctgacaggctgggccgatgtttctggagtgctggctgagctg
aaggatgagaagcggaagctggagcgtgagcggccactgtccctgctccagctcctgggc
agccgtacccaccggcagcccctgatcattgcggtcgtgctgcagctgagccagcagctc
tctggcatcaatgctgttttctattattcgaccagcatcttcgagacagcaggggtaggc
cagcctgcctatgccaccataggagctggtgtggtcaacacagtcttcaccttggtctcg
gtgttgttggtggagcgggcggggcgccggacgctccatctcctgggcctggcgggcatg
tgtggctgtgccatcctgatgactgtggctctgctcctgctggagcgagttccagccatg
agctacgtctccattgtggccatctttggcttcgtggcattttttgagattggccctggc
cccattccttggttcatcgtggccgagctcttcagccagggaccccgcccggcagccatg
gctgtggctggtttctccaactggacgagcaacttcatcattggcatgggtttccagtat
gttgcggaggctatggggccctacgtcttccttctatttgcggtcctcctgctgggcttc
ttcatcttcaccttcttaagagtacctgaaactcgaggccggacgtttgaccagatctca
gctgccttccaccggacaccctctcttttagagcaggaggtgaaacccagcacagaactt
gagtatttagggccagatgagaacgactga

DBGET integrated database retrieval system