KEGG   Homo sapiens (human): 6517Help
Entry
6517              CDS       T01001                                 

Gene name
SLC2A4, GLUT4
Definition
solute carrier family 2 (facilitated glucose transporter), member 4
Orthology
K07191  
MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 4
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    6517 (SLC2A4)
   04152 AMPK signaling pathway
    6517 (SLC2A4)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    6517 (SLC2A4)
   04920 Adipocytokine signaling pathway
    6517 (SLC2A4)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    6517 (SLC2A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13
AA seq 509 aa AA seqDB search
MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETW
LGRQGPEGPSSIPPGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAV
LGGSLMGLANAAASYEMLILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAI
VIGILIAQVLGLESLLGTASLWPLLLGLTVLPALLQLVLLPFCPESPRYLYIIQNLEGPA
RKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLSQQL
SGINAVFYYSTSIFETAGVGQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGM
CGCAILMTVALLLLERVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAM
AVAGFSNWTSNFIIGMGFQYVAEAMGPYVFLLFAVLLLGFFIFTFLRVPETRGRTFDQIS
AAFHRTPSLLEQEVKPSTELEYLGPDEND
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgggcttccaacagataggctccgaagatggggaaccccctcagcagcgagtg
actgggaccctggtccttgctgtgttctctgcggtgcttggctccctgcagtttgggtac
aacattggggtcatcaatgcccctcagaaggtgattgaacagagctacaatgagacgtgg
ctggggaggcaggggcctgagggacccagctccatccctccaggcaccctcaccaccctc
tgggccctctccgtggccatcttttccgtgggcggcatgatttcctccttcctcattggt
atcatctctcagtggcttggaaggaaaagggccatgctggtcaacaatgtcctggcggtg
ctggggggcagcctcatgggcctggccaatgctgctgcctcctatgaaatgctcatcctt
ggacgattcctcattggcgcctactcagggctgacatcagggctggtgcccatgtacgtg
ggggagattgctcccactcacctgcggggcgccctggggacgctcaaccaactggccatt
gttatcggcattctgatcgcccaggtgctgggcttggagtccctcctgggcactgccagc
ctgtggccactgctcctgggcctcacagtgctacctgccctcctgcagctggtcctgctg
cccttctgtcccgagagcccccgctacctctacatcatccagaatctcgaggggcctgcc
agaaagagtctgaagcgcctgacaggctgggccgatgtttctggagtgctggctgagctg
aaggatgagaagcggaagctggagcgtgagcggccactgtccctgctccagctcctgggc
agccgtacccaccggcagcccctgatcattgcggtcgtgctgcagctgagccagcagctc
tctggcatcaatgctgttttctattattcgaccagcatcttcgagacagcaggggtaggc
cagcctgcctatgccaccataggagctggtgtggtcaacacagtcttcaccttggtctcg
gtgttgttggtggagcgggcggggcgccggacgctccatctcctgggcctggcgggcatg
tgtggctgtgccatcctgatgactgtggctctgctcctgctggagcgagttccagccatg
agctacgtctccattgtggccatctttggcttcgtggcattttttgagattggccctggc
cccattccttggttcatcgtggccgagctcttcagccagggaccccgcccggcagccatg
gctgtggctggtttctccaactggacgagcaacttcatcattggcatgggtttccagtat
gttgcggaggctatggggccctacgtcttccttctatttgcggtcctcctgctgggcttc
ttcatcttcaccttcttaagagtacctgaaactcgaggccggacgtttgaccagatctca
gctgccttccaccggacaccctctcttttagagcaggaggtgaaacccagcacagaactt
gagtatttagggccagatgagaacgactga

DBGET integrated database retrieval system