KEGG   Homo sapiens (human): 6518Help
Entry
6518              CDS       T01001                                 

Gene name
SLC2A5, GLUT-5, GLUT5
Definition
(RefSeq) solute carrier family 2 member 5
  KO
K08143  
MFS transporter, SP family, solute carrier family 2 (facilitated glucose/fructose transporter), member 5
Organism
hsa  Homo sapiens (human)
Pathway
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    6518 (SLC2A5)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC2: Facilitative GLUT transporter
   6518 (SLC2A5)
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    6518 (SLC2A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
1p36.2
AA seq 501 aa AA seqDB search
MEQQDQSMKEGRLTLVLALATLIAAFGSSFQYGYNVAAVNSPALLMQQFYNETYYGRTGE
FMEDFPLTLLWSVTVSMFPFGGFIGSLLVGPLVNKFGRKGALLFNNIFSIVPAILMGCSR
VATSFELIIISRLLVGICAGVSSNVVPMYLGELAPKNLRGALGVVPQLFITVGILVAQIF
GLRNLLANVDGWPILLGLTGVPAALQLLLLPFFPESPRYLLIQKKDEAAAKKALQTLRGW
DSVDREVAEIRQEDEAEKAAGFISVLKLFRMRSLRWQLLSIIVLMGGQQLSGVNAIYYYA
DQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLGRRLLLLLGFSICLIACCVLT
AALALQDTVSWMPYISIVCVISYVIGHALGPSPIPALLITEIFLQSSRPSAFMVGGSVHW
LSNFTVGLIFPFIQEGLGPYSFIVFAVICLLTTIYIFLIVPETKAKTFIEINQIFTKMNK
VSEVYPEKEELKELPPVTSEQ
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggagcaacaggatcagagcatgaaggaagggaggctgacgcttgtgcttgccctggca
accctgatagctgcctttgggtcatccttccagtatgggtacaacgtggctgctgtcaac
tccccagcactgctcatgcaacaattttacaatgagacttactatggtaggaccggtgaa
ttcatggaagacttccccttgacgttgctgtggtctgtaaccgtgtccatgtttccattt
ggagggtttatcggatccctcctggtcggccccttggtgaataaatttggcagaaaaggg
gccttgctgttcaacaacatattttctatcgtgcctgcgatcttaatgggatgcagcaga
gtcgccacatcatttgagcttatcattatttccagacttttggtgggaatatgtgcaggt
gtatcttccaacgtggtccccatgtacttaggggagctggcccctaaaaacctgcggggg
gctctcggggtggtgccccagctcttcatcactgttggcatccttgtggcccagatcttt
ggtcttcggaatctccttgcaaacgtagatggctggccgatcctgctggggctgaccggg
gtccccgcggcgctgcagctccttctgctgcccttcttccccgagagccccaggtacctg
ctgattcagaagaaagacgaagcggccgccaagaaagccctacagacgctgcgcggctgg
gactctgtggacagggaggtggccgagatccggcaggaggatgaggcagagaaggccgcg
ggcttcatctccgtgctgaagctgttccggatgcgctcgctgcgctggcagctgctgtcc
atcatcgtcctcatgggcggccagcagctgtcgggcgtcaacgctatctactactacgcg
gaccagatctacctgagcgccggcgtgccggaggagcacgtgcagtacgtgacggccggc
accggggccgtgaacgtggtcatgaccttctgcgccgtgttcgtggtggagctcctgggt
cggaggctgctgctgctgctgggcttctccatctgcctcatagcctgctgcgtgctcact
gcagctctggcactgcaggacacagtgtcctggatgccatacatcagcatcgtctgtgtc
atctcctacgtcataggacatgccctcgggcccagtcccatacccgcgctgctcatcact
gagatcttcctgcagtcctctcggccatctgccttcatggtggggggcagtgtgcactgg
ctctccaacttcaccgtgggcttgatcttcccgttcatccaggagggcctcggcccgtac
agcttcattgtcttcgccgtgatctgcctcctcaccaccatctacatcttcttgattgtc
ccggagaccaaggccaagacgttcatagagatcaaccagattttcaccaagatgaataag
gtgtctgaagtgtacccggaaaaggaggaactgaaagagcttccacctgtcacttcggaa
cagtga

DBGET integrated database retrieval system