KEGG   Homo sapiens (human): 6518Help
Entry
6518              CDS       T01001                                 

Gene name
SLC2A5, GLUT-5, GLUT5
Definition
solute carrier family 2 (facilitated glucose/fructose transporter), member 5
Orthology
K08143  
MFS transporter, SP family, solute carrier family 2 (facilitated glucose/fructose transporter), member 5
Organism
hsa  Homo sapiens (human)
Pathway
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    6518 (SLC2A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
1p36.2
AA seq 244 aa AA seqDB search
MEQQDQSMKEGRLTLVLALATLIAAFGSSFQYGYNVAAVNSPALLMQQFYNETYYGRTGE
FMEDFPLTLLWSVTVSMFPFGGFIGSLLVGPLVNKFGRKGALLFNNIFSIVPAILMGCSR
VATSFELIIISRLLVGICAGVSSNVVPMYLGELAPKNLRGALGVVPQLFITVGILVAQIF
GLRNLLANVDGEFRTSREHPHPFTTTLGPLLVFQSHHHRTGLSADWSLLTGWMSLGGPSC
PEPT
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggagcaacaggatcagagcatgaaggaagggaggctgacgcttgtgcttgccctggca
accctgatagctgcctttgggtcatccttccagtatgggtacaacgtggctgctgtcaac
tccccagcactgctcatgcaacaattttacaatgagacttactatggtaggaccggtgaa
ttcatggaagacttccccttgacgttgctgtggtctgtaaccgtgtccatgtttccattt
ggagggtttatcggatccctcctggtcggccccttggtgaataaatttggcagaaaaggg
gccttgctgttcaacaacatattttctatcgtgcctgcgatcttaatgggatgcagcaga
gtcgccacatcatttgagcttatcattatttccagacttttggtgggaatatgtgcaggt
gtatcttccaacgtggtccccatgtacttaggggagctggcccctaaaaacctgcggggg
gctctcggggtggtgccccagctcttcatcactgttggcatccttgtggcccagatcttt
ggtcttcggaatctccttgcaaacgtagatggtgagttcaggacatctcgggagcacccc
caccccttcaccactacccttggccccctccttgtgttccaaagccaccaccacaggaca
ggactttctgcagactggtctcttctaacaggctggatgtccttggggggcccatcctgt
cccgagccaacatag

DBGET integrated database retrieval system