KEGG   Homo sapiens (human): 6519Help
Entry
6519              CDS       T01001                                 

Gene name
SLC3A1, ATR1, CSNU1, D2H, NBAT, RBAT
Definition
solute carrier family 3 (amino acid transporter heavy chain), member 1
Orthology
K14210  
solute carrier family 3 (neutral and basic amino acid transporter), member 1
Organism
hsa  Homo sapiens (human)
Pathway
Protein digestion and absorption
Disease
H00901  
Cystinuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    6519 (SLC3A1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   6519 (SLC3A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
2p16.3
AA seq 685 aa AA seqDB search
MAEDKSKRDSIEMSMKGCQTNNGFVHNEDILEQTPDPGSSTDNLKHSTRGILGSQEPDFK
GVQPYAGMPKEVLFQFSGQARYRIPREILFWLTVASVLVLIAATIAIIALSPKCLDWWQE
GPMYQIYPRSFKDSNKDGNGDLKGIQDKLDYITALNIKTVWITSFYKSSLKDFRYGVEDF
REVDPIFGTMEDFENLVAAIHDKGLKLIIDFIPNHTSDKHIWFQLSRTRTGKYTDYYIWH
DCTHENGKTIPPNNWLSVYGNSSWHFDEVRNQCYFHQFMKEQPDLNFRNPDVQEEIKEIL
RFWLTKGVDGFSLDAVKFLLEAKHLRDEIQVNKTQIPDTVTQYSELYHDFTTTQVGMHDI
VRSFRQTMDQYSTEPGRYRFMGTEAYAESIDRTVMYYGLPFIQEADFPFNNYLSMLDTVS
GNSVYEVITSWMENMPEGKWPNWMIGGPDSSRLTSRLGNQYVNVMNMLLFTLPGTPITYY
GEEIGMGNIVAANLNESYDINTLRSKSPMQWDNSSNAGFSEASNTWLPTNSDYHTVNVDV
QKTQPRSALKLYQDLSLLHANELLLNRGWFCHLRNDSHYVVYTRELDGIDRIFIVVLNFG
ESTLLNLHNMISGLPAKMRIRLSTNSADKGSKVDTSGIFLDKGEGLIFEHNTKNLLHRQT
AFRDRCFVSNRACYSSVLNILYTSC
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagataaaagcaagagagactccatcgagatgagtatgaagggatgccagaca
aacaacgggtttgtccataatgaagacattctggagcagaccccggatccaggaagctca
acagacaacctgaagcacagcaccaggggcatccttggctcccaggagcccgacttcaag
ggcgtccagccctatgcggggatgcccaaggaggtgctgttccagttctctggccaggcc
cgctaccgcatacctcgggagatcctcttctggctcacagtggcttctgtgctggtgctc
atcgcggccaccatagccatcattgccctctctccaaagtgcctagactggtggcaggag
gggcccatgtaccagatctacccaaggtctttcaaggacagtaacaaggatgggaacgga
gatctgaaaggtattcaagataaactggactacatcacagctttaaatataaaaactgtt
tggattacttcattttataaatcgtcccttaaagatttcagatatggtgttgaagatttc
cgggaagttgatcccatttttggaacgatggaagattttgagaatctggttgcagccata
catgataaaggtttaaaattaatcatcgatttcataccaaaccacacgagtgataaacat
atttggtttcaattgagtcggacacggacaggaaaatatactgattattatatctggcat
gactgtacccatgaaaatggcaaaaccattccacccaacaactggttaagtgtgtatgga
aactccagttggcactttgacgaagtgcgaaaccaatgttattttcatcagtttatgaaa
gagcaacctgatttaaatttccgcaatcctgatgttcaagaagaaataaaagaaatttta
cggttctggctcacaaagggtgttgatggttttagtttggatgctgttaaattcctccta
gaagcaaagcacctgagagatgagatccaagtaaataagacccaaatcccggacacggtc
acacaatactcggagctgtaccatgacttcaccaccacgcaggtgggaatgcacgacatt
gtccgcagcttccggcagaccatggaccaatacagcacggagcccggcagatacaggttc
atggggactgaagcctatgcagagagtattgacaggaccgtgatgtactatggattgcca
tttatccaagaagctgattttcccttcaacaattacctcagcatgctagacactgtttct
gggaacagcgtgtatgaggttatcacatcctggatggaaaacatgccagaaggaaaatgg
cctaactggatgattggtggaccagacagttcacggctgacttcgcgtttggggaatcag
tatgtcaacgtgatgaacatgcttcttttcacactccctggaactcctataacttactat
ggagaagaaattggaatgggaaatattgtagccgcaaatctcaatgaaagctatgatatt
aatacccttcgctcaaagtcaccaatgcagtgggacaatagttcaaatgctggtttttct
gaagctagtaacacctggttacctaccaattcagattaccacactgtgaatgttgatgtc
caaaagactcagcccagatcggctttgaagttatatcaagatttaagtctacttcatgcc
aatgagctactcctcaacaggggctggttttgccatttgaggaatgacagccactatgtt
gtgtacacaagagagctggatggcatcgacagaatctttatcgtggttctgaattttgga
gaatcaacactgttaaatctacataatatgatttcgggccttcccgctaaaatgagaata
aggttaagtaccaattctgccgacaaaggcagtaaagttgatacaagtggcatttttctg
gacaagggagagggactcatctttgaacacaacacgaagaatctccttcatcgccaaaca
gctttcagagatagatgctttgtttccaatcgagcatgctattccagtgtactgaacata
ctgtatacctcgtgttag

  All links  
No link information was found.   
DBGET integrated database retrieval system