KEGG   Homo sapiens (human): 652Help
Entry
652               CDS       T01001                                 

Gene name
BMP4, BMP2B, BMP2B1, MCOPS6, OFC11, ZYME
Definition
(RefSeq) bone morphogenetic protein 4
  KO
K04662  
bone morphogenetic protein 4
Organism
hsa  Homo sapiens (human)
Pathway
TGF-beta signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Thyroid hormone signaling pathway
Pathways in cancer
Basal cell carcinoma
Fluid shear stress and atherosclerosis
Module
BMP signaling
Disease
H00516  
Isolated orofacial clefts
H01027  
Anophthalmia and microphthalmia (A/M)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    652 (BMP4)
   04390 Hippo signaling pathway
    652 (BMP4)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    652 (BMP4)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    652 (BMP4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    652 (BMP4)
   05217 Basal cell carcinoma
    652 (BMP4)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    652 (BMP4)
Cytokines [BR:hsa04052]
 TGF-beta family
  BMP2 subfamily
   652 (BMP4)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens (General comment) Effective diffusion, tissue differentiation, development
   652 (BMP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P12644(Tchem)
UniProt: 
Position
14q22.2
AA seq 408 aa AA seqDB search
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEAT
LLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPERPASRANTVRSF
HHEEHLENIPGTSENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWERGFHRINI
YEVMKPPAEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTH
LHQTRTHQGQHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQR
ARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTL
VNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgattcctggtaaccgaatgctgatggtcgttttattatgccaagtcctgctaggaggc
gcgagccatgctagtttgatacctgagacggggaagaaaaaagtcgccgagattcagggc
cacgcgggaggacgccgctcagggcagagccatgagctcctgcgggacttcgaggcgaca
cttctgcagatgtttgggctgcgccgccgcccgcagcctagcaagagtgccgtcattccg
gactacatgcgggatctttaccggcttcagtctggggaggaggaggaagagcagatccac
agcactggtcttgagtatcctgagcgcccggccagccgggccaacaccgtgaggagcttc
caccacgaagaacatctggagaacatcccagggaccagtgaaaactctgcttttcgtttc
ctctttaacctcagcagcatccctgagaacgaggtgatctcctctgcagagcttcggctc
ttccgggagcaggtggaccagggccctgattgggaaaggggcttccaccgtataaacatt
tatgaggttatgaagcccccagcagaagtggtgcctgggcacctcatcacacgactactg
gacacgagactggtccaccacaatgtgacacggtgggaaacttttgatgtgagccctgcg
gtccttcgctggacccgggagaagcagccaaactatgggctagccattgaggtgactcac
ctccatcagactcggacccaccagggccagcatgtcaggattagccgatcgttacctcaa
gggagtgggaattgggcccagctccggcccctcctggtcacctttggccatgatggccgg
ggccatgccttgacccgacgccggagggccaagcgtagccctaagcatcactcacagcgg
gccaggaagaagaataagaactgccggcgccactcgctctatgtggacttcagcgatgtg
ggctggaatgactggattgtggccccaccaggctaccaggccttctactgccatggggac
tgcccctttccactggctgaccacctcaactcaaccaaccatgccattgtgcagaccctg
gtcaattctgtcaattccagtatccccaaagcctgttgtgtgcccactgaactgagtgcc
atctccatgctgtacctggatgagtatgataaggtggtactgaaaaattatcaggagatg
gtagtagagggatgtgggtgccgctga

DBGET integrated database retrieval system