KEGG   Homo sapiens (human): 65220Help
Entry
65220             CDS       T01001                                 

Gene name
NADK, dJ283E3.1
Definition
NAD kinase (EC:2.7.1.23)
Orthology
K00858  
NAD+ kinase [EC:2.7.1.23]
Organism
hsa  Homo sapiens (human)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    65220 (NADK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.23  NAD+ kinase
     65220 (NADK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.33
AA seq 446 aa AA seqDB search
MEMEQEKMTMNKELSPDAAAYCCSACHGDETWSYNHPIRGRAKSRSLSASPALGSTKEFR
RTRSLHGPCPVTTFGPKACVLQNPQTIMHIQDPASQRLTWNKSPKSVLVIKKMRDASLLQ
PFKELCTHLMEENMIVYVEKKVLEDPAIASDESFGAVKKKFCTFREDYDDISNQIDFIIC
LGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFSFENFQSQVTQVIEGNAAVVLRSRL
KVRVVKELRGKKTAVHNGLGENGSQAAGLDMDVGKQAMQYQVLNEVVIDRGPSSYLSNVD
VYLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMITPICPHSLSFRPIVV
PAGVELKIMLSPEARNTAWVSFDGRKRQEIRHGDSISITTSCYPLPSICVRDPVSDWFES
LAQCLHWNVRKKQAHFEEEEEEEEEG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggaacaagaaaaaatgaccatgaataaggaattgagtccagacgcggctgct
tactgctgctcggcctgccacggcgatgagacctggagttacaaccaccccatccggggc
cgggccaagtctcgcagcctgtctgcctcgcccgccctggggagcaccaaggagttcagg
aggacacgctctcttcatgggccatgcccggtgaccacttttggaccaaaggcctgtgtg
ctgcagaacccccagaccatcatgcacattcaggaccccgcgagccagcggctgacgtgg
aacaagtccccaaagagcgtccttgtcatcaagaagatgagagatgccagcctactgcag
ccgttcaaggagctctgcacgcacctcatggaggagaacatgatcgtgtatgtggaaaag
aaagtgctagaagaccctgccatcgccagcgatgaaagctttggggcagtgaagaagaaa
ttctgtacctttcgagaagattatgatgacatttccaatcagatagacttcatcatctgc
ctggggggagacgggacgctgctgtacgcttcctcgcttttccagggcagcgtccctccg
gtcatggccttccacctgggctccctgggcttcctgaccccattcagctttgagaacttt
cagtcccaagttactcaggtgatagaggggaacgcagctgttgttctccggagtcggctg
aaggtcagggtggtgaaggagctccgggggaagaagacggccgtgcacaatgggctgggt
gagaacggctcgcaggctgcaggcctggacatggatgtcgggaagcaggccatgcagtac
caggtcctgaatgaggtggtgattgacagaggcccctcctcctacctgtccaatgtggat
gtctacctggacggacacctcatcaccacggtgcagggcgacggagtgatcgtgtccacc
ccgacgggcagcacggcgtatgcggccgcggccggggcctccatgatccaccccaacgtg
ccggccatcatgatcacgcccatctgcccccactcgctgtccttccggcccatcgtggtc
cccgcaggggtcgagctgaagatcatgctgtcacctgaagcaaggaacacagcatgggtg
tcctttgatggacggaagagacaagagatccgccatggagacagcatcagcatcactacc
tcatgctacccgctcccctccatctgtgtgcgggaccccgtgagcgactggtttgagagc
ctcgcccagtgcctgcattggaacgtccggaagaagcaagcccacttcgaggaggaggag
gaggaggaggaggagggctag

DBGET integrated database retrieval system