KEGG   Homo sapiens (human): 6524Help
Entry
6524              CDS       T01001                                 

Gene name
SLC5A2, SGLT2
Definition
(RefSeq) solute carrier family 5 member 2
  KO
K14382  
solute carrier family 5 (sodium/glucose cotransporter), member 2
Organism
hsa  Homo sapiens (human)
Disease
H01126  
Familial renal glucosuria (FRG)
Drug target
Dapagliflozin [DG:DG00122]: 
Canagliflozin: 
Empagliflozin: 
Other: 
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC5: Sodium glucose cotransporter
   6524 (SLC5A2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   6524 (SLC5A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p11.2
AA seq 672 aa AA seqDB search
MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGR
SMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYLTA
GVITMPQYLRKRFGGRRIRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIA
LLGITMIYTVTGGLAALMYTDTVQTFVILGGACILMGYAFHEVGGYSGLFDKYLGAATSL
TVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQR
CLAGKSLTHIKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPEVCRRVCGTEVG
CSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDR
ELLLVGRLWVVFIVVVSVAWLPVVQAAQGGQLFDYIQAVSSYLAPPVSAVFVLALFVPRV
NEQGAFWGLIGGLLMGLARLIPEFSFGSGSCVQPSACPAFLCGVHYLYFAIVLFFCSGLL
TLTVSLCTAPIPRKHLHRLVFSLRHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQ
APAPSLFRQCLLWFCGMSRGGVGSPPPLTQEEAAAAARRLEDISEDPSWARVVNLNALLM
MAVAVFLWGFYA
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcacacagaggcaggctcggcaccagagatgggggcccagaaggccctgatt
gacaatcctgctgacatcctagtcattgctgcatatttcctgctggtcattggcgttggc
ttgtggtccatgtgcagaaccaacagaggcactgtgggcggctacttcctggcaggacgc
agcatggtgtggtggccggttggggcctctctcttcgccagcaacatcggcagtggccac
tttgtgggcctggcagggactggcgctgcaagtggcttggctgttgctggattcgagtgg
aatgcgctcttcgtggtgctgctactgggctggctgtttgcacccgtgtacctgacagcg
ggggtcatcacgatgccacagtacctgcgcaagcgcttcggcggccgccgcatccgcctc
tacctgtctgtgctctcccttttcctgtacatcttcaccaagatctcagtggacatgttc
tccggagctgtattcatccagcaggctctgggctggaacatctatgcctccgtcatcgcg
cttctgggcatcaccatgatttacacggtgacaggagggctggccgcgctgatgtacacg
gacacggtacagaccttcgtcattctggggggcgcctgcatcctcatgggttacgccttc
cacgaggtgggcgggtattcgggtctcttcgacaaatacctgggagcagcgacttcgctg
acggtgtccgaggatccagccgtgggaaacatctccagcttctgctatcgaccccggccc
gactcctaccacctgctccggcaccccgtgaccggggatctgccgtggcccgcgctgctc
ctcggactcacaatcgtctcgggctggtactggtgcagcgaccaggtcatcgtgcagcgc
tgcctggccgggaagagcctgacccacatcaaggcgggctgcatcctgtgtgggtacctg
aagctgacgcccatgtttctcatggtcatgccaggcatgatcagccgcattctgtaccca
gacgaggtggcgtgcgtggtgcctgaggtgtgcaggcgcgtgtgcggcacggaggtgggc
tgctccaacatcgcctacccgcggctcgtcgtgaagctcatgcccaacggtctgcgcgga
ctcatgctggcggtcatgctggccgcgctcatgtcctcgctggcctccatcttcaacagc
agcagcacgctcttcaccatggacatctacacgcgcctgcggccacgcgccggcgaccgc
gagctgctgctggtgggacggctctgggtggtgttcatcgtggtagtgtcggtggcctgg
cttcccgtggtgcaggcggcacagggcgggcagctcttcgattacatccaggcagtctct
agctacctggcaccgcccgtgtccgccgtcttcgtgctggcgctcttcgtgccgcgcgtt
aatgagcagggcgccttctggggactcatcgggggcctgctgatgggcctggcacgcctg
attcccgagttctccttcggctcgggcagctgtgtgcagccctcggcgtgcccagctttc
ctctgcggcgtgcactacctctacttcgccattgtgctgttcttctgctctggcctcctc
accctcacggtctccctgtgcaccgcgcccatccccagaaagcacctccaccgcctggtc
ttcagtctccggcatagcaaggaggaacgggaggacctggatgctgatgagcagcaaggc
tcctcactccctgtacagaatgggtgcccagagagtgccatggagatgaatgagccccag
gccccggcaccaagcctcttccgccagtgcctgctctggttttgtggaatgagcagaggt
ggggtgggcagtcctccgccccttacccaggaggaggcagcggcagcagccaggcggctg
gaggacatcagcgaggacccgagctgggcccgtgtggtcaacctcaatgccctgctcatg
atggcagtggccgtgttcctctggggcttctatgcctaa

DBGET integrated database retrieval system