KEGG   Homo sapiens (human): 65264Help
Entry
65264             CDS       T01001                                 

Gene name
UBE2Z, HOYS7, USE1
Definition
(RefSeq) ubiquitin conjugating enzyme E2 Z (EC:2.3.2.23)
  KO
K10585  
ubiquitin-conjugating enzyme E2 Z [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    65264 (UBE2Z)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     65264 (UBE2Z)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   65264 (UBE2Z)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q21.32
AA seq 354 aa AA seqDB search
MAESPTEEAATAGAGAAGPGASSVAGVVGVSGSGGGFGPPFLPDVWAAAAAAGGAGGPGS
GLAPLPGLPPSAAAHGAALLSHWDPTLSSDWDGERTAPQCLLRIKRDIMSIYKEPPPGMF
VVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPN
FYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNY
NECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDP
FGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcggagagtccgactgaggaggcggcaacggcgggcgccggggcggcgggccccggg
gcgagcagcgttgctggtgttgttggcgttagcggcagcggcggcgggttcgggccgcct
ttcctgccggatgtgtgggcggcggcggcggcagcgggcggggccgggggcccggggagc
ggcctggctccgctgcccgggctcccgccctcagccgctgcccacggggccgcgctgctt
agccactgggaccccacgctcagctccgactgggacggcgagcgcaccgcgccgcagtgt
ctactccggatcaagcgggatatcatgtccatttataaggagcctcctccaggaatgttc
gttgtacctgatactgttgacatgactaagattcatgcattgatcacaggcccatttgac
actccttatgaagggggtttcttcctgttcgtgtttcggtgtccgcccgactatcccatc
cacccacctcgggtcaaactgatgacaacgggcaataacacagtgaggtttaaccccaac
ttctaccgcaatgggaaagtctgcttgagtattctaggtacatggactggacctgcctgg
agcccagcccagagcatctcctcagtgctcatctctatccagtccctgatgactgagaac
ccctatcacaatgagcccggctttgaacaggagagacatccaggagacagcaaaaactat
aatgaatgtatccggcacgagaccatcagagttgcagtctgtgacatgatggaaggaaag
tgtccctgtcctgaacccctacgaggggtgatggagaagtcctttctggagtattacgac
ttctacgaggtggcctgcaaagatcgcctgcaccttcaaggccaaactatgcaggaccct
tttggagagaagcggggccactttgactaccagtccctcttgatgcgcctgggactgata
cgtcagaaagtgctggagaggctccataatgagaatgcagaaatggactctgatagcagt
tcatctgggacagagacagaccttcatgggagcctgagggtttag

DBGET integrated database retrieval system