KEGG   Homo sapiens (human): 65264Help
Entry
65264             CDS       T01001                                 

Gene name
UBE2Z, USE1
Definition
ubiquitin-conjugating enzyme E2Z (EC:6.3.2.19)
Orthology
K10585  
ubiquitin-conjugating enzyme E2 Z [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    65264 (UBE2Z)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     65264 (UBE2Z)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21.32
AA seq 354 aa AA seqDB search
MAESPTEEAATAGAGAAGPGASSVAGVVGVSGSGGGFGPPFLPDVWAAAAAAGGAGGPGS
GLAPLPGLPPSAAAHGAALLSHWDPTLSSDWDGERTAPQCLLRIKRDIMSIYKEPPPGMF
VVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPN
FYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNY
NECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDP
FGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcggagagtccgactgaggaggcggcaacggcgggcgccggggcggcgggccccggg
gcgagcagcgttgctggtgttgttggcgttagcggcagcggcggcgggttcgggccgcct
ttcctgccggatgtgtgggcggcggcggcggcagcgggcggggccgggggcccggggagc
ggcctggctccgctgcccgggctcccgccctcagccgctgcccacggggccgcgctgctt
agccactgggaccccacgctcagctccgactgggacggcgagcgcaccgcgccgcagtgt
ctactccggatcaagcgggatatcatgtccatttataaggagcctcctccaggaatgttc
gttgtacctgatactgttgacatgactaagattcatgcattgatcacaggcccatttgac
actccttatgaagggggtttcttcctgttcgtgtttcggtgtccgcccgactatcccatc
cacccacctcgggtcaaactgatgacaacgggcaataacacagtgaggtttaaccccaac
ttctaccgcaatgggaaagtctgcttgagtattctaggtacatggactggacctgcctgg
agcccagcccagagcatctcctcagtgctcatctctatccagtccctgatgactgagaac
ccctatcacaatgagcccggctttgaacaggagagacatccaggagacagcaaaaactat
aatgaatgtatccggcacgagaccatcagagttgcagtctgtgacatgatggaaggaaag
tgtccctgtcctgaacccctacgaggggtgatggagaagtcctttctggagtattacgac
ttctacgaggtggcctgcaaagatcgcctgcaccttcaaggccaaactatgcaggaccct
tttggagagaagcggggccactttgactaccagtccctcttgatgcgcctgggactgata
cgtcagaaagtgctggagaggctccataatgagaatgcagaaatggactctgatagcagt
tcatctgggacagagacagaccttcatgggagcctgagggtttag

DBGET integrated database retrieval system