KEGG   Homo sapiens (human): 65268Help
Entry
65268             CDS       T01001                                 

Gene name
WNK2, NY-CO-43, P/OKcl.13, PRKWNK2, SDCCAG43
Definition
(RefSeq) WNK lysine deficient protein kinase 2 (EC:2.7.11.1)
  KO
K08867  
WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     65268 (WNK2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  Wnk family
   65268 (WNK2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     65268 (WNK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q22.3
AA seq 2297 aa AA seqDB search
MDGDGGRRDVPGTLMEPGRGAGPAGMAEPRAKAARPGPQRFLRRSVVESDQEEPPGLEAA
EAPGPQPPQPLQRRVLLLCKTRRLIAERARGRPAAPAPAALVAQPGAPGAPADAGPEPVG
TQEPGPDPIAAAVETAPAPDGGPREEAAATVRKEDEGAAEAKPEPGRTRRDEPEEEEDDE
DDLKAVATSLDGRFLKFDIELGRGSFKTVYKGLDTETWVEVAWCELQDRKLTKLERQRFK
EEAEMLKGLQHPNIVRFYDFWESSAKGKRCIVLVTELMTSGTLKTYLKRFKVMKPKVLRS
WCRQILKGLLFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGT
PEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTCGIKPASFEK
VHDPEIKEIIGECICKNKEERYEIKDLLSHAFFAEDTGVRVELAEEDHGRKSTIALRLWV
EDPKKLKGKPKDNGAIEFTFDLEKETPDEVAQEMIESGFFHESDVKIVAKSIRDRVALIQ
WRRERIWPALQPKEQQDVGSPDKARGPPVPLQVQVTYHAQAGQPGPPEPEEPEADQHLLP
PTLPTSATSLASDSTFDSGQGSTVYSDSQSSQQSVMLGSLADAAPSPAQCVCSPPVSEGP
VLPQSLPSLGAYQQPTAAPGLPVGSVPAPACPPSLQQHFPDPAMSFAPVLPPPSTPMPTG
PGQPAPPGQQPPPLAQPTPLPQVLAPQPVVPLQPVPPHLPPYLAPASQVGAPAQLKPLQM
PQAPLQPLAQVPPQMPPIPVVPPITPLAGIDGLPPALPDLPTATVPPVPPPQYFSPAVIL
PSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPATIPLLAVAPPGVAALSIH
SAVAQLPGQPVYPAAFPQMAPTDVPPSPHHTVQNMRATPPQPALPPQPTLPPQPVLPPQP
TLPPQPVLPPQPTRPPQPVLPPQPMLPPQPVLPPQPALPVRPEPLQPHLPEQAAPAATPG
SQILLGHPAPYAVDVAAQVPTVPVPPAAVLSPPLPEVLLPAAPELLPQFPSSLATVSASV
QSVPTQTATLLPPANPPLPGGPGIASPCPTVQLTVEPVQEEQASQDKPPGLPQSCESYGG
SDVTSGKELSDSCEGAFGGGRLEGRAARKHHRRSTRARSRQERASRPRLTILNVCNTGDK
MVECQLETHNHKMVTFKFDLDGDAPDEIATYMVEHDFILQAERETFIEQMKDVMDKAEDM
LSEDTDADRGSDPGTSPPHLSTCGLGTGEESRQSQANAPVYQQNVLHTGKRWFIICPVAE
HPAPEAPESSPPLPLSSLPPEASQGPCRGLTLPCLPWRRAACGAVFLSLFSAESAQSKQP
PDSAPYKDQLSSKEQPSFLASQQLLSQAGPSNPPGAPPAPLAPSSPPVTALPQDGAAPAT
STMPEPASGTASQAGGPGTPQGLTSELETSQPLAETHEAPLAVQPLVVGLAPCTPAPEAA
STRDASAPREPLPPPAPEPSPHSGTPQPALGQPAPLLPAAVGAVSLATSQLPSPPLGPTV
PPQPPSALESDGEGPPPRVGFVDSTIKSLDEKLRTLLYQEHVPTSSASAGTPVEVGDRDF
TLEPLRGDQPRSEVCGGDLALPPVPKEAVSGRVQLPQPLVEKSELAPTRGAVMEQGTSSS
MTAESSPRSMLGYDRDGRQVASDSHVVPSVPQDVPAFVRPARVEPTDRDGGEAGESSAEP
PPSDMGTVGGQASHPQTLGARALGSPRKRPEQQDVSSPAKTVGRFSVVSTQDEWTLASPH
SLRYSAPPDVYLDEAPSSPDVKLAVRRAQTASSIEVGVGEPVSSDSGDEGPRARPPVQKQ
ASLPVSGSVAGDFVKKATAFLQRPSRAGSLGPETPSRVGMKVPTISVTSFHSQSSYISSD
NDSELEDADIKKELQSLREKHLKEISELQSQQKQEIEALYRRLGKPLPPNVGFFHTAPPT
GRRRKTSKSKLKAGKLLNPLVRQLKVVASSTGHLADSSRGPPAKDPAQASVGLTADSTGL
SGKAVQTQQPCSVRASLSSDICSGLASDGGGARGQGWTVYHPTSERVTYKSSSKPRARFL
SGPVSVSIWSALKRLCLGKEHSSRSSTSSLAPGPEPGPQPALHVQAQVNNSNNKKGTFTD
DLHKLVDEWTSKTVGAAQLKPTLNQLKQTQKLQDMEAQAGWAAPGEARAMTAPRAGVGMP
RLPPAPGPLSTTVIPGAAPTLSVPTPDGALGTARRNQVWFGLRVPPTACCGHSTQPRGGQ
RVGSKTASFAASDPVRS
NT seq 6894 nt NT seq  +upstreamnt  +downstreamnt
atggacggcgatggcggccgccgagacgtccccggcacgctgatggagcccgggcgcggc
gcggggcccgcgggcatggcggagcctcgggcgaaggcggcgcggccggggccccagcgc
tttctgcggcgcagcgtggtagagtcggaccaggaggagccgccgggcttggaggcagcc
gaggcgccgggcccgcagcccccgcagcccctgcagcgccgggtgcttctgctctgcaag
acgcgccgcctcatcgcggagcgcgcccgcggacgccccgccgcccccgcgcccgcagcg
ctggtagcgcagccgggagcccccggagcccccgcggacgccggccccgagcccgtgggc
acgcaggagcccggcccggaccccatcgcagccgctgtcgaaaccgcgcctgcccccgac
ggcggccccagggaggaggcggcggcgaccgtgaggaaggaggatgagggggcggccgag
gcgaagcctgagcccgggcgcactcgccgggacgagcccgaagaggaggaggacgacgag
gacgacctcaaggccgtggccacctctctggacggccgcttcctcaagttcgacatcgag
ctgggccgcggttccttcaagacggtctacaaggggctggacacggagacctgggtggag
gtggcctggtgtgagctgcaggaccggaagctcaccaagctggagcggcagcggttcaag
gaagaggctgagatgctgaaaggcctgcagcaccccaacatcgtgcgcttctacgacttc
tgggagtccagcgccaagggcaagcggtgcattgtgctggtgacggagctgatgacctca
gggacgctgaagacatacctgaagcggttcaaggtgatgaagcccaaggttctccgcagc
tggtgccggcagatcctgaagggcctgctgttcctgcacacaaggacgccacccatcatc
caccgagacctgaaatgtgacaatattttcatcaccggaccaactgggtctgtgaagatt
ggcgacttgggcctggccactctgaaaagagcgtcatttgccaaaagtgtgataggtact
cccgagttcatggcgcccgagatgtacgaggagcactacgatgagtccgtggacgtctat
gcctttgggatgtgcatgctggagatggccacctcggagtacccctactcggagtgccag
aatgcggcccagatctaccgcaaggtcacctgtggtatcaagccggccagctttgagaaa
gtgcacgatcctgaaatcaaggagattattggggagtgtatctgcaaaaacaaggaggaa
aggtacgagatcaaagacctgctgagccacgccttcttcgcagaggacacaggcgtgagg
gtggagctcgcggaggaggaccacggcaggaagtccaccatcgccctgaggctctgggtg
gaagaccccaagaaactgaagggaaagcccaaggacaatggagccatagagttcaccttc
gacctggagaaggagacgccggatgaggtggcccaagagatgattgagtctggattcttc
cacgagagtgacgtcaagatcgtggccaagtccatccgtgaccgcgtggccttgatccag
tggcggcgggagaggatctggcccgcgctgcagcccaaggagcagcaggatgtgggcagc
ccggacaaggccaggggtccgccggtgcccctgcaggtccaggtgacctaccatgcacag
gctgggcagcccgggccaccagagcccgaggagccggaggccgaccagcacctcctgcca
cctacgttgccgaccagcgccacctccctggcctcggacagcaccttcgacagcggccag
ggctctaccgtgtactcagactcgcagagcagccagcagagcgtgatgcttggctccctt
gccgacgcagcgccgtccccggcccagtgtgtgtgcagcccccctgtgagcgaggggccc
gtcctgccgcagagcctgccctcgctgggggcctaccagcagcccacggctgcacctggc
ttgccggtgggctctgtcccggcccccgcctgccctccgtccctccagcagcacttcccg
gatccggccatgagcttcgcccccgtgctgccgccgcccagcacccccatgcccacgggc
ccaggccagccagcaccccccggccagcagcctcctccgctggcccagccgacacccctg
ccgcaggtcctggccccacagcccgtggtccccctccagccggttcccccccacctgcca
ccgtacctggctccagcctcccaggtgggggcccccgctcagctgaagcccctccagatg
ccacaggcgcccctgcagccgcttgctcaagtccctccgcagatgcccccgattcctgtt
gtgccccccatcacgcccctggcgggaatcgacggcctccctccggccctcccagacctg
ccgaccgcgactgtgcctcccgtgccaccacctcagtatttctctccagccgtgatcttg
ccgagcctcgctgccccactcccccctgcgtccccagccttgcctctgcaggctgtgaag
ctgccccacccccctggggcgcccctggccatgccctgccggaccattgtgccaaatgca
ccggccactatccccctgctggccgtagccccaccgggcgtggctgccctgtccattcat
tctgccgtggcccagctcccaggccaacctgtgtacccagcggccttcccacagatggcg
cctactgacgtccctccttccccccatcacacggtgcagaatatgagggccacccctcca
cagccggcactgcctccacaacccacactgcccccacaacccgtgctgcccccgcaaccc
acgctgccccctcaacctgtgttgcccccgcaacccacacggccccctcaacctgtgctg
cccccgcaacccatgctgcccccacaacctgtgctgcccccgcagccggcactgcctgtg
cgccctgagcccctccagccccaccttcctgaacaagctgctccagctgctacaccaggg
agccagattctgcttggccacccagctccctatgctgtggacgtcgccgctcaggtcccc
accgtgcctgtgccaccggctgcggtcctctcgccgcctctgccggaagtgctgctgcct
gccgcccctgagctcctgcctcagttccccagctccctggccacggtgtctgcctctgtg
cagagtgtgcccacccagactgccacacttctgccaccagcaaacccaccgctgcctggc
gggcccgggatcgccagcccttgcccaactgtccagctgacggtggaaccagtccaagag
gagcaggcctcacaggacaagccgcccggcctcccgcagagctgtgagagctatggaggt
tctgatgtcacttctggaaaagagctgagtgacagctgtgaaggcgcctttggagggggc
aggctggagggcagggcagcccgaaaacaccaccgcaggtccacgcgtgcgcgctcccgg
caggagagggccagccggccccggcttaccatcttgaacgtgtgcaacactggggacaag
atggtggagtgccagctggagacgcacaaccacaagatggtgaccttcaagttcgacttg
gacggggacgcacccgatgaaattgccacgtatatggtggagcatgactttatcctgcag
gccgagcgggaaacgttcatcgagcagatgaaggatgtcatggacaaggcagaggacatg
ctcagcgaggacacagacgccgaccgtggctccgacccagggaccagcccgccacacctc
agcacctgcggcctgggcaccggggaggagagccgacaatcccaagccaacgcccccgtg
tatcagcagaacgtcctgcacaccgggaagaggtggttcatcatctgtccggtggctgag
caccccgcccccgaggcccctgaatcttcgcccccacttcctctaagctccctgccgcca
gaagccagccaaggtccatgcagggggctcaccctgccctgtctcccatggcgcagagca
gcctgtggggctgtgttcctatccttgttttctgctgaatcagctcagtcaaagcagcct
ccagattcagcgccctataaagaccagctgtcctcgaaggaacaacccagctttctagcc
agtcagcagctcctgagccaggcgggccccagcaaccctcctggggcacccccagcccct
ttggccccctcctcccctcctgtgactgctctgccccaagatggagcagctccagccacc
agcaccatgccagagccagcgtcaggaactgccagccaggcagggggtccagggacacct
caggggctgaccagtgagctcgagacgtctcagccactagcggagactcacgaggccccg
cttgctgtgcagcccctcgtggtgggcctagcaccttgcactccagctccagaggctgcc
tcaaccagggacgccagtgccccaagggagcccctgccacctcctgcacctgagcccagc
ccccacagcgggaccccacagcccgccttgggtcaacctgctcccctgcttcctgccgca
gtgggggccgtcagcctggccacctcccagctcccaagcccacccctggggcccaccgtc
cccccacagccaccctcggccctggagtcggatggggaagggccgccccccagggtgggc
tttgtggacagcaccatcaagagcctggacgagaagctgcggactctgctctaccaggag
cacgtgcccacctcctcagcctcagctgggacccctgtggaggtgggcgacagagacttc
accctggagcccctgagaggggaccagccccgctcagaggtctgcgggggggacctggcc
ctgcccccagtgcctaaggaggcggtctcagggcgtgtccagctgccccagcccttggtg
gagaagtcagaactggcccccactcgaggggccgtgatggagcagggcacgtcctcgtca
atgacagcagagtcgtctcccaggagtatgctaggctatgacagagatggaaggcaggtg
gcctcagactcccatgtggtccccagcgtcccccaggatgtacctgcttttgtgagacct
gcacgtgtggagcccacagacagggatggtggagaagctggagaaagctcggcagagccc
ccgccgagtgacatgggcacagtggggggccaggctagccacccccagacactcggcgct
cgagctttggggtcccctcggaaacgtccagagcagcaggatgtcagctcaccagccaag
actgtgggccgtttctcggtggtcagcactcaggacgagtggaccctggcctccccccac
agcctgagatactctgccccacccgacgtctacctggacgaggccccctccagccccgac
gtgaagctggcagtgcggcgggcgcagacggcctcctccatcgaggtcggcgtgggcgag
cccgtgtccagcgactctggggacgagggccctcgggcgagacccccggtgcagaagcag
gcgtccctgcccgtgagtggcagcgtggctggcgacttcgtgaagaaggccaccgccttc
ctgcagaggccttctcgggccggctcgctgggccccgagacacccagcagggtgggcatg
aaggtccccacgatcagcgtgacctccttccattcccagtcgtcctacatcagcagcgac
aatgattcggagctcgaggatgctgacataaagaaggagctgcagagtctgcgggagaag
cacctgaaggagatctcggagctgcagagccagcagaagcaggagatcgaagctctgtac
cgccgcctgggcaagccactgccccccaacgtgggcttcttccacacggcaccccccact
ggccgccggagaaaaaccagcaagagcaagctgaaggcaggcaagctgctaaatcccctg
gtgcggcagctcaaggtcgtggcctccagcacaggtcacttggctgactccagcagaggc
cctcccgctaaggaccctgcccaagccagtgtggggctcactgcagacagcacgggcctg
agcgggaaggcagtgcagacccagcagccctgctccgtccgggcctccctgtcttcggac
atctgctccggcttagccagtgatggaggcggagcgcgtggccaaggctggacggtttac
cacccaacgtctgagagagtgacctataagtctagtagcaaacctcgtgctcgattcctc
agtggacccgtatctgtgtccatctggtctgccctgaagcgtctctgcctaggcaaagaa
cacagcagtaggtcctccaccagcagcctggccccaggccctgagccaggcccccagccc
gccctgcacgtccaggcgcaggtgaacaacagcaacaacaagaagggtaccttcacggac
gacctgcacaagctggtggacgagtggacgagcaagacggtgggggccgcgcagctgaag
cccacgctcaaccagctgaagcagacccagaagctgcaagacatggaggcccaggcaggc
tgggctgcccctggcgaggcgcgggctatgaccgcacctcgagcaggagtggggatgcca
cgtctgcccccagcgcccggccctctgtccaccacggtcattcccggagccgccccgacc
ctgtccgtgcccacaccagatggcgccctcggaaccgcccggagaaaccaggtgtggttt
ggcctccgagtcccccccaccgcctgctgtgggcacagcactcagccgcgagggggacag
cgggtgggcagcaagactgcttcctttgcggcttcagaccctgttcgctcctag

DBGET integrated database retrieval system