KEGG   Homo sapiens (human): 6531Help
Entry
6531              CDS       T01001                                 

Gene name
SLC6A3, DAT, DAT1, PKDYS
Definition
solute carrier family 6 (neurotransmitter transporter), member 3
Orthology
K05036  
solute carrier family 6 (neurotransmitter transporter, dopamine) member 3
Organism
hsa  Homo sapiens (human)
Pathway
Dopaminergic synapse
Parkinson's disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Drug target
Mazindol: 
Sibutramine: 
Cocaine: 
Amfetamine: 
Dexamfetamine: 
Metamfetamine: 
Lisdexamfetamine: 
Iodine ioflupane (123I): 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    6531 (SLC6A3)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    6531 (SLC6A3)
  Substance dependence
   05030 Cocaine addiction
    6531 (SLC6A3)
   05031 Amphetamine addiction
    6531 (SLC6A3)
   05034 Alcoholism
    6531 (SLC6A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5p15.3
AA seq 620 aa AA seqDB search
MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDR
ETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPILKGVGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHC
NNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPRWQL
TACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAIDGIRAYLSV
DFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTTSINSLTSFSS
GFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGI
DSAMGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIYVFTLLDHFAA
GTSILFGVLIEAIGVAWFYGVGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSI
VTFRPPHYGAYIFPDWANALGWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKD
RELVDRGEVRQFTLRHWLKV
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagagcaaatgctccgtgggactcatgtcttccgtggtggccccggctaaggag
cccaatgccgtgggcccgaaggaggtggagctcatccttgtcaaggagcagaacggagtg
cagctcaccagctccaccctcaccaacccgcggcagagccccgtggaggcccaggatcgg
gagacctggggcaagaagatcgactttctcctgtccgtcattggctttgctgtggacctg
gccaacgtctggcggttcccctacctgtgctacaaaaatggtggcggtgccttcctggtc
ccctacctgctcttcatggtcattgctgggatgccacttttctacatggagctggccctc
ggccagttcaacagggaaggggccgctggtgtctggaagatctgccccatactgaaaggt
gtgggcttcacggtcatcctcatctcactgtatgtcggcttcttctacaacgtcatcatc
gcctgggcgctgcactatctcttctcctccttcaccacggagctcccctggatccactgc
aacaactcctggaacagccccaactgctcggatgcccatcctggtgactccagtggagac
agctcgggcctcaacgacacttttgggaccacacctgctgccgagtactttgaacgtggc
gtgctgcacctccaccagagccatggcatcgacgacctggggcctccgcggtggcagctc
acagcctgcctggtgctggtcatcgtgctgctctacttcagcctctggaagggcgtgaag
acctcagggaaggtggtatggatcacagccaccatgccatacgtggtcctcactgccctg
ctcctgcgtggggtcaccctccctggagccatagacggcatcagagcatacctgagcgtt
gacttctaccggctctgcgaggcgtctgtttggattgacgcggccacccaggtgtgcttc
tccctgggcgtggggttcggggtgctgatcgccttctccagctacaacaagttcaccaac
aactgctacagggacgcgattgtcaccacctccatcaactccctgacgagcttctcctcc
ggcttcgtcgtcttctccttcctggggtacatggcacagaagcacagtgtgcccatcggg
gacgtggccaaggacgggccagggctgatcttcatcatctacccggaagccatcgccacg
ctccctctgtcctcagcctgggccgtggtcttcttcatcatgctgctcaccctgggtatc
gacagcgccatgggtggtatggagtcagtgatcaccgggctcatcgatgagttccagctg
ctgcacagacaccgtgagctcttcacgctcttcatcgtcctggcgaccttcctcctgtcc
ctgttctgcgtcaccaacggtggcatctacgtcttcacgctcctggaccattttgcagcc
ggcacgtccatcctctttggagtgctcatcgaagccatcggagtggcctggttctatggt
gttgggcagttcagcgacgacatccagcagatgaccgggcagcggcccagcctgtactgg
cggctgtgctggaagctggtcagcccctgctttctcctgttcgtggtcgtggtcagcatt
gtgaccttcagacccccccactacggagcctacatcttccccgactgggccaacgcgctg
ggctgggtcatcgccacatcctccatggccatggtgcccatctatgcggcctacaagttc
tgcagcctgcctgggtcctttcgagagaaactggcctacgccattgcacccgagaaggac
cgtgagctggtggacagaggggaggtgcgccagttcacgctccgccactggctcaaggtg
tag

DBGET integrated database retrieval system