KEGG   Homo sapiens (human): 6531Help
Entry
6531              CDS       T01001                                 

Gene name
SLC6A3, DAT, DAT1, PKDYS
Definition
solute carrier family 6 (neurotransmitter transporter), member 3
Orthology
K05036  
solute carrier family 6 (neurotransmitter transporter, dopamine) member 3
Organism
hsa  Homo sapiens (human)
Pathway
Dopaminergic synapse
Parkinson's disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Drug target
Mazindol: 
Sibutramine: 
Cocaine: 
Amfetamine: 
Dexamfetamine: 
Metamfetamine: 
Lisdexamfetamine: 
Iodine ioflupane (123I): 
Other: 
Class
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
Human Diseases; Substance dependence; Cocaine addiction [PATH:hsa05030]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:hsa05031]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5p15.3
AA seq 620 aa AA seqDB search
MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDR
ETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPILKGVGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHC
NNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPRWQL
TACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAIDGIRAYLSV
DFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTTSINSLTSFSS
GFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGI
DSAMGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIYVFTLLDHFAA
GTSILFGVLIEAIGVAWFYGVGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSI
VTFRPPHYGAYIFPDWANALGWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKD
RELVDRGEVRQFTLRHWLKV
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagagcaaatgctccgtgggactcatgtcttccgtggtggccccggctaaggag
cccaatgccgtgggcccgaaggaggtggagctcatccttgtcaaggagcagaacggagtg
cagctcaccagctccaccctcaccaacccgcggcagagccccgtggaggcccaggatcgg
gagacctggggcaagaagatcgactttctcctgtccgtcattggctttgctgtggacctg
gccaacgtctggcggttcccctacctgtgctacaaaaatggtggcggtgccttcctggtc
ccctacctgctcttcatggtcattgctgggatgccacttttctacatggagctggccctc
ggccagttcaacagggaaggggccgctggtgtctggaagatctgccccatactgaaaggt
gtgggcttcacggtcatcctcatctcactgtatgtcggcttcttctacaacgtcatcatc
gcctgggcgctgcactatctcttctcctccttcaccacggagctcccctggatccactgc
aacaactcctggaacagccccaactgctcggatgcccatcctggtgactccagtggagac
agctcgggcctcaacgacacttttgggaccacacctgctgccgagtactttgaacgtggc
gtgctgcacctccaccagagccatggcatcgacgacctggggcctccgcggtggcagctc
acagcctgcctggtgctggtcatcgtgctgctctacttcagcctctggaagggcgtgaag
acctcagggaaggtggtatggatcacagccaccatgccatacgtggtcctcactgccctg
ctcctgcgtggggtcaccctccctggagccatagacggcatcagagcatacctgagcgtt
gacttctaccggctctgcgaggcgtctgtttggattgacgcggccacccaggtgtgcttc
tccctgggcgtggggttcggggtgctgatcgccttctccagctacaacaagttcaccaac
aactgctacagggacgcgattgtcaccacctccatcaactccctgacgagcttctcctcc
ggcttcgtcgtcttctccttcctggggtacatggcacagaagcacagtgtgcccatcggg
gacgtggccaaggacgggccagggctgatcttcatcatctacccggaagccatcgccacg
ctccctctgtcctcagcctgggccgtggtcttcttcatcatgctgctcaccctgggtatc
gacagcgccatgggtggtatggagtcagtgatcaccgggctcatcgatgagttccagctg
ctgcacagacaccgtgagctcttcacgctcttcatcgtcctggcgaccttcctcctgtcc
ctgttctgcgtcaccaacggtggcatctacgtcttcacgctcctggaccattttgcagcc
ggcacgtccatcctctttggagtgctcatcgaagccatcggagtggcctggttctatggt
gttgggcagttcagcgacgacatccagcagatgaccgggcagcggcccagcctgtactgg
cggctgtgctggaagctggtcagcccctgctttctcctgttcgtggtcgtggtcagcatt
gtgaccttcagacccccccactacggagcctacatcttccccgactgggccaacgcgctg
ggctgggtcatcgccacatcctccatggccatggtgcccatctatgcggcctacaagttc
tgcagcctgcctgggtcctttcgagagaaactggcctacgccattgcacccgagaaggac
cgtgagctggtggacagaggggaggtgcgccagttcacgctccgccactggctcaaggtg
tag

DBGET integrated database retrieval system