KEGG   Homo sapiens (human): 653129Help
Entry
653129            CDS       T01001                                 

Gene name
PTPN20A, CT126, PTPN20B, bA142I17.1, hPTPN20
Definition
protein tyrosine phosphatase, non-receptor type 20A (EC:3.1.3.48)
Orthology
K18039  
tyrosine-protein phosphatase non-receptor type 20 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
10q11.22
AA seq 226 aa AA seqDB search
MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSKVFENKVNSEKVKLSLRN
FPHNDYEDVFEEPSESGSDPSMWTARGPFRRDRWSSEDEEAAGPSQALSPLLSDTRKIVS
EGELDQLAQIRPLIFNFHEQTAIKDCLKILEEKTAAYDIMQEFMALELKNLPGEFNSGNQ
PSNREKNRYRDILPFQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcacctagggactttagagcagagcctgtaaacgattatgagggaaatgactct
gaagcagaagacttgaatttcagggagactttgccttcatcaagtcaggaaaacacacct
agatcaaaggtttttgaaaataaagttaattcagagaaggtaaaactttctcttcggaat
ttcccacataatgattatgaggatgtttttgaagagccttcagaaagtggcagtgatccc
agcatgtggacagccagaggccccttcagaagagacaggtggagcagtgaggatgaggag
gctgcagggccatcacaggctctctcccctctactttctgatacgcgcaaaattgtttct
gaaggagaactagatcagttggctcagattcggccattaatattcaattttcatgagcag
acagccatcaaggattgtttgaaaatccttgaggaaaaaacagcagcgtatgatatcatg
caggaatttatggctttagaacttaagaatctgcctggtgagttcaactctgggaatcaa
ccaagcaacagagaaaaaaacagataccgagatattcttccatttcaacatcatggatat
agtggcccaaatgagagaacaacgttctggcatggttcaaacgaaggagcagtatcactt
ttgttacgatattgtgcttga

DBGET integrated database retrieval system