KEGG   Homo sapiens (human): 6532Help
Entry
6532              CDS       T01001                                 

Gene name
SLC6A4, 5-HTT, 5-HTTLPR, 5HTT, HTT, OCD1, SERT, SERT1, hSERT
Definition
(RefSeq) solute carrier family 6 member 4
  KO
K05037  
solute carrier family 6 (neurotransmitter transporter, serotonin) member 4
Organism
hsa  Homo sapiens (human)
Pathway
Serotonergic synapse
Disease
H01450  
Obsessive-compulsive disorder (OCD)
Drug target
Dexfenfluramine [DG:DG00105]: 
Mazindol: 
Sibutramine [DG:DG00108]: 
Dapoxetine: 
Cocaine [DG:DG00808]: 
Desipramine [DG:DG00927]: 
Imipramine [DG:DG00928]: 
Clomipramine [DG:DG00929]: 
Trimipramine [DG:DG00931]: 
Lofepramine [DG:DG00932]: 
Amitriptyline [DG:DG00934]: 
Nortriptyline [DG:DG00935]: 
Doxepin [DG:DG00937]: 
Dosulepin [DG:DG00940]: 
Amoxapine: 
Zimeldine: 
Fluoxetine [DG:DG00942]: 
Citalopram [DG:DG00943]: 
Paroxetine [DG:DG00944]: 
Sertraline [DG:DG00945]: 
Alaproclate: 
Fluvoxamine [DG:DG00946]: 
Etoperidone: 
Escitalopram [DG:DG00947]: 
Trazodone [DG:DG00952]: 
Venlafaxine [DG:DG00959]: 
Milnacipran [DG:DG00960]: 
Duloxetine [DG:DG00962]: 
Desvenlafaxine [DG:DG00963]: 
Vilazodone [DG:DG00964]: 
Amfetamine [DG:DG00966]: 
Dexamfetamine [DG:DG00967]: 
Metamfetamine [DG:DG00968]: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    6532 (SLC6A4)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   6532 (SLC6A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q11.2
AA seq 630 aa AA seqDB search
METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTR
HSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLP
YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIM
AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIH
RSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGA
TLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD
ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS
TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVT
LTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRIC
WVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIIT
PGTFKERIIKSITPETPTEIPCGDIRLNAV
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggagacgacgcccttgaattctcagaagcagctatcagcgtgtgaagatggagaagat
tgtcaggaaaacggagttctacagaaggttgttcccaccccaggggacaaagtggagtcc
gggcaaatatccaatgggtactcagcagttccaagtcctggtgcgggagatgacacacgg
cactctatcccagcgaccaccaccaccctagtggctgagcttcatcaaggggaacgggag
acctggggcaagaaggtggatttccttctctcagtgattggctatgctgtggacctgggc
aatgtctggcgcttcccctacatatgttaccagaatggagggggggcattcctcctcccc
tacaccatcatggccatttttgggggaatcccgctcttttacatggagctcgcactggga
cagtaccaccgaaatggatgcatttcaatatggaggaaaatctgcccgattttcaaaggg
attggttatgccatctgcatcattgccttttacattgcttcctactacaacaccatcatg
gcctgggcgctatactacctcatctcctccttcacggaccagctgccctggaccagctgc
aagaactcctggaacactggcaactgcaccaattacttctccgaggacaacatcacctgg
accctccattccacgtcccctgctgaagaattttacacgcgccacgtcctgcagatccac
cggtctaaggggctccaggacctggggggcatcagctggcagctggccctctgcatcatg
ctgatcttcactgttatctacttcagcatctggaaaggcgtcaagacctctggcaaggtg
gtgtgggtgacagccaccttcccttatatcatcctttctgtcctgctggtgaggggtgcc
accctccctggagcctggaggggtgttctcttctacttgaaacccaattggcagaaactc
ctggagacaggggtgtggatagatgcagccgctcagatcttcttctctcttggtccgggc
tttggggtcctgctggcttttgctagctacaacaagttcaacaacaactgctaccaagat
gccctggtgaccagcgtggtgaactgcatgacgagcttcgtttcgggatttgtcatcttc
acagtgctcggttacatggctgagatgaggaatgaagatgtgtctgaggtggccaaagac
gcaggtcccagcctcctcttcatcacgtatgcagaagcgatagccaacatgccagcgtcc
actttctttgccatcatcttctttctgatgttaatcacgctgggcttggacagcacgttt
gcaggcttggagggggtgatcacggctgtgctggatgagttcccacacgtctgggccaag
cgccgggagcggttcgtgctcgccgtggtcatcacctgcttctttggatccctggtcacc
ctgacttttggaggggcctacgtggtgaagctgctggaggagtatgccacggggcccgca
gtgctcactgtcgcgctgatcgaagcagtcgctgtgtcttggttctatggcatcactcag
ttctgcagggacgtgaaggaaatgctcggcttcagcccggggtggttctggaggatctgc
tgggtggccatcagccctctgtttctcctgttcatcatttgcagttttctgatgagcccg
ccacaactacgacttttccaatataattatccttactggagtatcatcttgggttactgc
ataggaacctcatctttcatttgcatccccacatatatagcttatcggttgatcatcact
ccagggacatttaaagagcgtattattaaaagtattaccccagaaacaccaacagaaatt
ccttgtggggacatccgcttgaatgctgtgtaa

DBGET integrated database retrieval system