KEGG   Homo sapiens (human): 6532Help
Entry
6532              CDS       T01001                                 

Gene name
SLC6A4, 5-HTT, 5-HTTLPR, 5HTT, HTT, OCD1, SERT, SERT1, hSERT
Definition
solute carrier family 6 (neurotransmitter transporter), member 4
Orthology
K05037  
solute carrier family 6 (neurotransmitter transporter, serotonin) member 4
Organism
hsa  Homo sapiens (human)
Pathway
Serotonergic synapse
Drug target
Dexfenfluramine: 
Mazindol: 
Sibutramine: 
Dapoxetine: 
Cocaine: 
Desipramine: 
Imipramine: 
Clomipramine: 
Trimipramine: 
Lofepramine: 
Amitriptyline: 
Nortriptyline: 
Dosulepin: 
Amoxapine: 
Fluoxetine: 
Citalopram: 
Paroxetine: 
Sertraline: 
Fluvoxamine: 
Escitalopram: 
Trazodone: 
Viloxazine: 
Venlafaxine: 
Milnacipran: 
Duloxetine: 
Desvenlafaxine: 
Vilazodone: 
Amfetamine: 
Dexamfetamine: 
Metamfetamine: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    6532 (SLC6A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q11.2
AA seq 630 aa AA seqDB search
METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTR
HSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLP
YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIM
AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIH
RSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGA
TLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD
ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS
TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVT
LTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRIC
WVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIIT
PGTFKERIIKSITPETPTEIPCGDIRLNAV
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggagacgacgcccttgaattctcagaagcagctatcagcgtgtgaagatggagaagat
tgtcaggaaaacggagttctacagaaggttgttcccaccccaggggacaaagtggagtcc
gggcaaatatccaatgggtactcagcagttccaagtcctggtgcgggagatgacacacgg
cactctatcccagcgaccaccaccaccctagtggctgagcttcatcaaggggaacgggag
acctggggcaagaaggtggatttccttctctcagtgattggctatgctgtggacctgggc
aatgtctggcgcttcccctacatatgttaccagaatggagggggggcattcctcctcccc
tacaccatcatggccatttttgggggaatcccgctcttttacatggagctcgcactggga
cagtaccaccgaaatggatgcatttcaatatggaggaaaatctgcccgattttcaaaggg
attggttatgccatctgcatcattgccttttacattgcttcctactacaacaccatcatg
gcctgggcgctatactacctcatctcctccttcacggaccagctgccctggaccagctgc
aagaactcctggaacactggcaactgcaccaattacttctccgaggacaacatcacctgg
accctccattccacgtcccctgctgaagaattttacacgcgccacgtcctgcagatccac
cggtctaaggggctccaggacctggggggcatcagctggcagctggccctctgcatcatg
ctgatcttcactgttatctacttcagcatctggaaaggcgtcaagacctctggcaaggtg
gtgtgggtgacagccaccttcccttatatcatcctttctgtcctgctggtgaggggtgcc
accctccctggagcctggaggggtgttctcttctacttgaaacccaattggcagaaactc
ctggagacaggggtgtggatagatgcagccgctcagatcttcttctctcttggtccgggc
tttggggtcctgctggcttttgctagctacaacaagttcaacaacaactgctaccaagat
gccctggtgaccagcgtggtgaactgcatgacgagcttcgtttcgggatttgtcatcttc
acagtgctcggttacatggctgagatgaggaatgaagatgtgtctgaggtggccaaagac
gcaggtcccagcctcctcttcatcacgtatgcagaagcgatagccaacatgccagcgtcc
actttctttgccatcatcttctttctgatgttaatcacgctgggcttggacagcacgttt
gcaggcttggagggggtgatcacggctgtgctggatgagttcccacacgtctgggccaag
cgccgggagcggttcgtgctcgccgtggtcatcacctgcttctttggatccctggtcacc
ctgacttttggaggggcctacgtggtgaagctgctggaggagtatgccacggggcccgca
gtgctcactgtcgcgctgatcgaagcagtcgctgtgtcttggttctatggcatcactcag
ttctgcagggacgtgaaggaaatgctcggcttcagcccggggtggttctggaggatctgc
tgggtggccatcagccctctgtttctcctgttcatcatttgcagttttctgatgagcccg
ccacaactacgacttttccaatataattatccttactggagtatcatcttgggttactgc
ataggaacctcatctttcatttgcatccccacatatatagcttatcggttgatcatcact
ccagggacatttaaagagcgtattattaaaagtattaccccagaaacaccaacagaaatt
ccttgtggggacatccgcttgaatgctgtgtaa

DBGET integrated database retrieval system