KEGG   Homo sapiens (human): 6532Help
Entry
6532              CDS       T01001                                 

Gene name
SLC6A4, 5-HTT, 5-HTTLPR, 5HTT, HTT, OCD1, SERT, SERT1, hSERT
Definition
(RefSeq) solute carrier family 6 member 4
  KO
K05037  
solute carrier family 6 (neurotransmitter transporter, serotonin) member 4
Organism
hsa  Homo sapiens (human)
Pathway
Serotonergic synapse
Disease
H01450  
Obsessive-compulsive disorder (OCD)
Drug target
Alaproclate: 
Amfetamine (DG00966): 
Amitifadine (DG01386): 
Amitriptyline (DG00934): 
Amitriptylinoxide: 
Amoxapine: 
Bicifadine hydrochloride: 
Citalopram (DG00943): 
Clomipramine (DG00929): 
Cocaine (DG00808): 
Dapoxetine: 
Desipramine (DG00927): 
Desvenlafaxine (DG00963): 
Dexamfetamine (DG00967): 
Dexfenfluramine (DG00105): 
Dosulepin (DG00940): 
Doxepin (DG00937): 
Duloxetine (DG00962): 
Escitalopram (DG00947): 
Etoperidone: 
Fluoxetine (DG00942): 
Fluvoxamine (DG00946): 
Imipramine (DG00928): 
Imipraminoxide (DG01542): 
Levomilnacipran (DG01387): 
Liafensine: 
Lofepramine (DG00932): 
Mazindol: 
Metamfetamine (DG00968): 
Milnacipran (DG00960): 
Nortriptyline (DG00935): 
Paroxetine (DG00944): 
Pirandamine hydrochloride: 
Sertraline (DG00945): 
Sibutramine (DG00108): 
Trazodone (DG00952): 
Trimipramine (DG00931): 
Venlafaxine (DG00959): 
Vilazodone (DG00964): 
Zimeldine: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    6532 (SLC6A4)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   6532 (SLC6A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q11.2
AA seq 630 aa AA seqDB search
METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTR
HSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLP
YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIM
AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIH
RSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGA
TLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD
ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS
TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVT
LTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRIC
WVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIIT
PGTFKERIIKSITPETPTEIPCGDIRLNAV
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggagacgacgcccttgaattctcagaagcagctatcagcgtgtgaagatggagaagat
tgtcaggaaaacggagttctacagaaggttgttcccaccccaggggacaaagtggagtcc
gggcaaatatccaatgggtactcagcagttccaagtcctggtgcgggagatgacacacgg
cactctatcccagcgaccaccaccaccctagtggctgagcttcatcaaggggaacgggag
acctggggcaagaaggtggatttccttctctcagtgattggctatgctgtggacctgggc
aatgtctggcgcttcccctacatatgttaccagaatggagggggggcattcctcctcccc
tacaccatcatggccatttttgggggaatcccgctcttttacatggagctcgcactggga
cagtaccaccgaaatggatgcatttcaatatggaggaaaatctgcccgattttcaaaggg
attggttatgccatctgcatcattgccttttacattgcttcctactacaacaccatcatg
gcctgggcgctatactacctcatctcctccttcacggaccagctgccctggaccagctgc
aagaactcctggaacactggcaactgcaccaattacttctccgaggacaacatcacctgg
accctccattccacgtcccctgctgaagaattttacacgcgccacgtcctgcagatccac
cggtctaaggggctccaggacctggggggcatcagctggcagctggccctctgcatcatg
ctgatcttcactgttatctacttcagcatctggaaaggcgtcaagacctctggcaaggtg
gtgtgggtgacagccaccttcccttatatcatcctttctgtcctgctggtgaggggtgcc
accctccctggagcctggaggggtgttctcttctacttgaaacccaattggcagaaactc
ctggagacaggggtgtggatagatgcagccgctcagatcttcttctctcttggtccgggc
tttggggtcctgctggcttttgctagctacaacaagttcaacaacaactgctaccaagat
gccctggtgaccagcgtggtgaactgcatgacgagcttcgtttcgggatttgtcatcttc
acagtgctcggttacatggctgagatgaggaatgaagatgtgtctgaggtggccaaagac
gcaggtcccagcctcctcttcatcacgtatgcagaagcgatagccaacatgccagcgtcc
actttctttgccatcatcttctttctgatgttaatcacgctgggcttggacagcacgttt
gcaggcttggagggggtgatcacggctgtgctggatgagttcccacacgtctgggccaag
cgccgggagcggttcgtgctcgccgtggtcatcacctgcttctttggatccctggtcacc
ctgacttttggaggggcctacgtggtgaagctgctggaggagtatgccacggggcccgca
gtgctcactgtcgcgctgatcgaagcagtcgctgtgtcttggttctatggcatcactcag
ttctgcagggacgtgaaggaaatgctcggcttcagcccggggtggttctggaggatctgc
tgggtggccatcagccctctgtttctcctgttcatcatttgcagttttctgatgagcccg
ccacaactacgacttttccaatataattatccttactggagtatcatcttgggttactgc
ataggaacctcatctttcatttgcatccccacatatatagcttatcggttgatcatcact
ccagggacatttaaagagcgtattattaaaagtattaccccagaaacaccaacagaaatt
ccttgtggggacatccgcttgaatgctgtgtaa

DBGET integrated database retrieval system