KEGG   Homo sapiens (human): 6535Help
Entry
6535              CDS       T01001                                 

Gene name
SLC6A8, CCDS1, CRT, CRTR, CT1, CTR5
Definition
(RefSeq) solute carrier family 6 member 8
  KO
K05039  
solute carrier family 6 (neurotransmitter transporter, GABA) member 6/8/11/12/13
Organism
hsa  Homo sapiens (human)
Disease
H00480  
Non-syndromic X-linked mental retardation
H00577  
Syndromic X-linked mental retardation with epilepsy or seizures
H00849  
Creatine deficiency syndrome
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   6535 (SLC6A8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq28
AA seq 635 aa AA seqDB search
MAKKSAENGIYSVSGDEKKGPLIAPGPDGAPAKGDGPVGLGTPGGRLAVPPRETWTRQMD
FIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGS
INVWNICPLFKGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPD
CVEIFRHEDCANASLANLTCDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLL
ACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGIIYYLKPDWSKL
GSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVF
SILGFMAAEQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFV
GVEGFITGLLDLLPASYYFRFQREISVALCCALCFVIDLSMVTDGGMYVFQLFDYYSASG
TTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFFTPLVCMGIFIFNVV
YYEPLVYNNTYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQPIWG
LHHLEYRAQDADVRGLTTLTPVSESSKVVVVESVM
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaagagcgccgagaacggcatctatagcgtgtccggcgacgagaagaagggc
cccctcatcgcgcccgggcccgacggggccccggccaagggcgacggccccgtgggcctg
gggacacccggcggccgcctggccgtgccgccgcgcgagacctggacgcgccagatggac
ttcatcatgtcgtgcgtgggcttcgccgtgggcttgggcaacgtgtggcgcttcccctac
ctgtgctacaagaacggcggaggtgtgttccttattccctacgtcctgatcgccctggtt
ggaggaatccccattttcttcttagagatctcgctgggccagttcatgaaggccggcagc
atcaatgtctggaacatctgtcccctgttcaaaggcctgggctacgcctccatggtgatc
gtcttctactgcaacacctactacatcatggtgctggcctggggcttctattacctggtc
aagtcctttaccaccacgctgccctgggccacatgtggccacacctggaacactcccgac
tgcgtggagatcttccgccatgaagactgtgccaatgccagcctggccaacctcacctgt
gaccagcttgctgaccgccggtcccctgtcatcgagttctgggagaacaaagtcttgagg
ctgtctgggggactggaggtgccaggggccctcaactgggaggtgaccctttgtctgctg
gcctgctgggtgctggtctacttctgtgtctggaagggggtcaaatccacgggaaagatc
gtgtacttcactgctacattcccctacgtggtcctggtcgtgctgctggtgcgtggagtg
ctgctgcctggcgccctggatggcatcatttactatctcaagcctgactggtcaaagctg
gggtcccctcaggtgtggatagatgcggggacccagattttcttttcttacgccattggc
ctgggggccctcacagccctgggcagctacaaccgcttcaacaacaactgctacaaggac
gccatcatcctggctctcatcaacagtgggaccagcttctttgctggcttcgtggtcttc
tccatcctgggcttcatggctgcagagcagggcgtgcacatctccaaggtggcagagtca
gggccgggcctggccttcatcgcctacccgcgggctgtcacgctgatgccagtggcccca
ctctgggctgccctgttcttcttcatgctgttgctgcttggtctcgacagccagtttgta
ggtgtggagggcttcatcaccggcctcctcgacctcctcccggcctcctactacttccgt
ttccaaagggagatctctgtggccctctgttgtgccctctgctttgtcatcgatctctcc
atggtgactgatggcgggatgtacgtcttccagctgtttgactactactcggccagcggc
accaccctgctctggcaggccttttgggagtgcgtggtggtggcctgggtgtacggagct
gaccgcttcatggacgacattgcctgtatgatcgggtaccgaccttgcccctggatgaaa
tggtgctggtccttcttcaccccgctggtctgcatgggcatcttcatcttcaacgttgtg
tactacgagccgctggtctacaacaacacctacgtgtacccgtggtggggtgaggccatg
ggctgggccttcgccctgtcctccatgctgtgcgtgccgctgcacctcctgggctgcctc
ctcagggccaagggcaccatggctgagcgctggcagcacctgacccagcccatctggggc
ctccaccacttggagtaccgagctcaggacgcagatgtcaggggcctgaccaccctgacc
ccagtgtccgagagcagcaaggtcgtcgtggtggagagtgtcatgtga

DBGET integrated database retrieval system