KEGG   Homo sapiens (human): 653509Help
Entry
653509            CDS       T01001                                 

Gene name
SFTPA1, COLEC4, PSAP, PSP-A, PSPA, SFTP1, SFTPA1B, SP-A, SP-A1, SPA, SPA1
Definition
(RefSeq) surfactant protein A1
  KO
K10067  pulmonary surfactant-associated protein A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa05133  Pertussis
Disease
H01299  Idiopathic pulmonary fibrosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    653509 (SFTPA1)
 Human Diseases
  Infectious diseases
   05133 Pertussis
    653509 (SFTPA1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    653509 (SFTPA1)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 3: Collectins
   653509 (SFTPA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C Collagen
Motif
Other DBs
NCBI-GeneID: 653509
NCBI-ProteinID: NP_001158116
OMIM: 178630
HGNC: 10798
Ensembl: ENSG00000122852
Vega: OTTHUMG00000018565
Pharos: Q8IWL2(Tbio)
UniProt: Q8IWL2 A0A024QZP2
Position
10q22.3
AA seq 248 aa AA seqDB search
MWLCPLALNLILMAASGAVCEVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPM
GPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQ
TRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKK
YNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLY
SRLTICEF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgtgccctctggccctcaacctcatcttgatggcagcctctggtgctgtgtgc
gaagtgaaggacgtttgtgttggaagccctggtatccccggcactcctggatcccacggc
ctgccaggcagggacgggagagatggtctcaaaggagaccctggccctccaggccccatg
ggtccacctggagaaatgccatgtcctcctggaaatgatgggctgcctggagcccctggt
atccctggagagtgtggagagaagggggagcctggcgagaggggccctccagggcttcca
gctcatctagatgaggagctccaagccacactccacgactttagacatcaaatcctgcag
acaaggggagccctcagtctgcagggctccataatgacagtaggagagaaggtcttctcc
agcaatgggcagtccatcacttttgatgccattcaggaggcatgtgccagagcaggcggc
cgcattgctgtcccaaggaatccagaggaaaatgaggccattgcaagcttcgtgaagaag
tacaacacatatgcctatgtaggcctgactgagggtcccagccctggagacttccgctac
tcagacgggacccctgtaaactacaccaactggtaccgaggggagcccgcaggtcgggga
aaagagcagtgtgtggagatgtacacagatgggcagtggaatgacaggaactgcctgtac
tcccgactgaccatctgtgagttctga

DBGET integrated database retrieval system