KEGG   Homo sapiens (human): 653509Help
Entry
653509            CDS       T01001                                 

Gene name
SFTPA1, COLEC4, PSAP, PSP-A, PSPA, SFTP1, SFTPA1B, SP-A, SP-A1, SPA, SPA1
Definition
surfactant protein A1
Orthology
K10067  
pulmonary surfactant-associated protein A
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Pertussis
Disease
H01299  
Idiopathic pulmonary fibrosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    653509 (SFTPA1)
 Human Diseases
  Infectious diseases
   05133 Pertussis
    653509 (SFTPA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
UniProt: 
Position
10q22.3
AA seq 263 aa AA seqDB search
MRPCQVPGAATGPRAMWLCPLALNLILMAASGAVCEVKDVCVGSPGIPGTPGSHGLPGRD
GRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDE
ELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVP
RNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCV
EMYTDGQWNDRNCLYSRLTICEF
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaggccatgccaggtgccaggagcagcgactggacccagagccatgtggctgtgccct
ctggccctcaacctcatcttgatggcagcctctggtgctgtgtgcgaagtgaaggacgtt
tgtgttggaagccctggtatccccggcactcctggatcccacggcctgccaggcagggac
gggagagatggtctcaaaggagaccctggccctccaggccccatgggtccacctggagaa
atgccatgtcctcctggaaatgatgggctgcctggagcccctggtatccctggagagtgt
ggagagaagggggagcctggcgagaggggccctccagggcttccagctcatctagatgag
gagctccaagccacactccacgactttagacatcaaatcctgcagacaaggggagccctc
agtctgcagggctccataatgacagtaggagagaaggtcttctccagcaatgggcagtcc
atcacttttgatgccattcaggaggcatgtgccagagcaggcggccgcattgctgtccca
aggaatccagaggaaaatgaggccattgcaagcttcgtgaagaagtacaacacatatgcc
tatgtaggcctgactgagggtcccagccctggagacttccgctactcagacgggacccct
gtaaactacaccaactggtaccgaggggagcccgcaggtcggggaaaagagcagtgtgtg
gagatgtacacagatgggcagtggaatgacaggaactgcctgtactcccgactgaccatc
tgtgagttctga

DBGET integrated database retrieval system