KEGG   Homo sapiens (human): 6536Help
Entry
6536              CDS       T01001                                 

Gene name
SLC6A9, GLYT1
Definition
solute carrier family 6 (neurotransmitter transporter, glycine), member 9
Orthology
K05038  
solute carrier family 6 (neurotransmitter transporter, amino acid) member 5/7/9/14
Organism
hsa  Homo sapiens (human)
Drug target
Other: 
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p33
AA seq 633 aa AA seqDB search
MVGKGAKGMLNGAVPSEATKRDQNLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRN
GGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIG
IYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSH
LLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSG
KVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDAASQIFYSLG
CAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVA
DHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWI
LQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGH
RNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITYNHYQYPGWAVAIG
FLMALSSVLCIPLYAMFRLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTIAPS
PEDGFEVQPLHPDKAQIPIVGSNGSSRLQDSRI
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggtaggaaaaggtgccaaagggatgctgaatggtgctgtgcccagcgaggccaccaag
agggaccagaacctcaaacggggcaactggggcaaccagatcgagtttgtactgacgagc
gtgggctatgccgtgggcctgggcaatgtctggcgcttcccatacctctgctatcgcaac
gggggaggcgccttcatgttcccctacttcatcatgctcatcttctgcgggatccccctc
ttcttcatggagctctccttcggccagtttgcaagccaggggtgcctgggggtctggagg
atcagccccatgttcaaaggagtgggctatggtatgatggtggtgtccacctacatcggc
atctactacaatgtggtcatctgcatcgccttctactacttcttctcgtccatgacgcac
gtgctgccctgggcctactgcaataacccctggaacacgcatgactgcgccggtgtactg
gacgcctccaacctcaccaatggctctcggccagccgccttgcccagcaacctctcccac
ctgctcaaccacagcctccagaggaccagccccagcgaggagtactggaggctgtacgtg
ctgaagctgtcagatgacattgggaactttggggaggtgcggctgcccctccttggctgc
ctcggtgtctcctggttggtcgtcttcctctgcctcatccgaggggtcaagtcttcaggg
aaagtggtgtacttcacggccacgttcccctacgtggtgctgaccattctgtttgtccgc
ggagtgaccctggagggagcctttgacggcatcatgtactacctaaccccgcagtgggac
aagatcctggaggccaaggtgtggggtgatgctgcctcccagatcttctactcactgggc
tgcgcgtggggaggcctcatcaccatggcttcctacaacaagttccacaataactgttac
cgggacagtgtcatcatcagcatcaccaactgtgccaccagcgtctatgctggcttcgtc
atcttctccatcctcggcttcatggccaatcacctgggcgtggatgtgtcccgtgtggca
gaccacggccctggcctggccttcgtggcttaccccgaggccctcacactacttcccatc
tccccgctgtggtctctgctcttcttcttcatgcttatcctgctggggctgggcactcag
ttctgcctcctggagacgctggtcacagccattgtggatgaggtggggaatgagtggatc
ctgcagaaaaagacctatgtgaccttgggcgtggctgtggctggcttcctgctgggcatc
cccctcaccagccaggcaggcatctattggctgctgctgatggacaactatgcggccagc
ttctccttggtggtcatctcctgcatcatgtgtgtggccatcatgtacatctacgggcac
cggaactacttccaggacatccagatgatgctgggattcccaccacccctcttctttcag
atctgctggcgcttcgtctctcccgccatcatcttctttattctagttttcactgtgatc
cagtaccagccgatcacctacaaccactaccagtacccaggctgggccgtggccattggc
ttcctcatggctctgtcctccgtcctctgcatccccctctacgccatgttccggctctgc
cgcacagacggggacaccctcctccagcgtttgaaaaatgccacaaagccaagcagagac
tggggccctgccctcctggagcaccggacagggcgctacgcccccaccatagccccctct
cctgaggacggcttcgaggtccagccactgcacccggacaaggcgcagatccccattgtg
ggcagtaatggctccagccgcctccaggactcccggatatga

DBGET integrated database retrieval system