KEGG   Homo sapiens (human): 6536Help
Entry
6536              CDS       T01001                                 

Gene name
SLC6A9, GLYT1
Definition
(RefSeq) solute carrier family 6 member 9
  KO
K05038  
solute carrier family 6 (neurotransmitter transporter, amino acid) member 5/7/9/14
Organism
hsa  Homo sapiens (human)
Drug target
Other: 
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   6536 (SLC6A9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p33
AA seq 706 aa AA seqDB search
MSGGDTRAAIARPRMAAAHGPVAPSSPEQVTLLPVQRSFFLPPFSGATPSTSLAESVLKV
WHGAYNSGLLPQLMAQHSLAMAQNGAVPSEATKRDQNLKRGNWGNQIEFVLTSVGYAVGL
GNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKG
VGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLDASNLTN
GSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLV
VFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKV
WGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGF
MANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETL
VTAIVDEVGNEWILQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVIS
CIMCVAIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITY
NHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGDTLLQRLKNATKPSRDWGPALLE
HRTGRYAPTIAPSPEDGFEVQPLHPDKAQIPIVGSNGSSRLQDSRI
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcggagacacgcgggctgcgatcgctcgccccaggatggccgcggctcatgga
cctgtggccccctcttccccagaacaggtgacgcttctccctgttcagagatccttcttc
ctgccacccttttctggagccactccctctacttccctagcagagtctgtcctcaaagtc
tggcatggggcctacaactctggtctccttccccaactcatggcccagcactccctagcc
atggcccagaatggtgctgtgcccagcgaggccaccaagagggaccagaacctcaaacgg
ggcaactggggcaaccagatcgagtttgtactgacgagcgtgggctatgccgtgggcctg
ggcaatgtctggcgcttcccatacctctgctatcgcaacgggggaggcgccttcatgttc
ccctacttcatcatgctcatcttctgcgggatccccctcttcttcatggagctctccttc
ggccagtttgcaagccaggggtgcctgggggtctggaggatcagccccatgttcaaagga
gtgggctatggtatgatggtggtgtccacctacatcggcatctactacaatgtggtcatc
tgcatcgccttctactacttcttctcgtccatgacgcacgtgctgccctgggcctactgc
aataacccctggaacacgcatgactgcgccggtgtactggacgcctccaacctcaccaat
ggctctcggccagccgccttgcccagcaacctctcccacctgctcaaccacagcctccag
aggaccagccccagcgaggagtactggaggctgtacgtgctgaagctgtcagatgacatt
gggaactttggggaggtgcggctgcccctccttggctgcctcggtgtctcctggttggtc
gtcttcctctgcctcatccgaggggtcaagtcttcagggaaagtggtgtacttcacggcc
acgttcccctacgtggtgctgaccattctgtttgtccgcggagtgaccctggagggagcc
tttgacggcatcatgtactacctaaccccgcagtgggacaagatcctggaggccaaggtg
tggggtgatgctgcctcccagatcttctactcactgggctgcgcgtggggaggcctcatc
accatggcttcctacaacaagttccacaataactgttaccgggacagtgtcatcatcagc
atcaccaactgtgccaccagcgtctatgctggcttcgtcatcttctccatcctcggcttc
atggccaatcacctgggcgtggatgtgtcccgtgtggcagaccacggccctggcctggcc
ttcgtggcttaccccgaggccctcacactacttcccatctccccgctgtggtctctgctc
ttcttcttcatgcttatcctgctggggctgggcactcagttctgcctcctggagacgctg
gtcacagccattgtggatgaggtggggaatgagtggatcctgcagaaaaagacctatgtg
accttgggcgtggctgtggctggcttcctgctgggcatccccctcaccagccaggcaggc
atctattggctgctgctgatggacaactatgcggccagcttctccttggtggtcatctcc
tgcatcatgtgtgtggccatcatgtacatctacgggcaccggaactacttccaggacatc
cagatgatgctgggattcccaccacccctcttctttcagatctgctggcgcttcgtctct
cccgccatcatcttctttattctagttttcactgtgatccagtaccagccgatcacctac
aaccactaccagtacccaggctgggccgtggccattggcttcctcatggctctgtcctcc
gtcctctgcatccccctctacgccatgttccggctctgccgcacagacggggacaccctc
ctccagcgtttgaaaaatgccacaaagccaagcagagactggggccctgccctcctggag
caccggacagggcgctacgcccccaccatagccccctctcctgaggacggcttcgaggtc
cagccactgcacccggacaaggcgcagatccccattgtgggcagtaatggctccagccgc
ctccaggactcccggatatga

DBGET integrated database retrieval system