KEGG   Homo sapiens (human): 6538Help
Entry
6538              CDS       T01001                                 

Gene name
SLC6A11, GAT-3, GAT3, GAT4
Definition
(RefSeq) solute carrier family 6 member 11
  KO
K05039  
solute carrier family 6 (neurotransmitter transporter, GABA) member 6/8/11/12/13
Organism
hsa  Homo sapiens (human)
Pathway
GABAergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    6538 (SLC6A11)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   6538 (SLC6A11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
3p25.3
AA seq 632 aa AA seqDB search
MTAEKALPLGNGKAAEEARESEAPGGGCSSGGAAPARHPRVKRDKAVHERGHWNNKVEFV
LSVAGEIIGLGNVWRFPYLCYKNGGGAFLIPYVVFFICCGIPVFFLETALGQFTSEGGIT
CWRKVCPLFEGIGYATQVIEAHLNVYYIIILAWAIFYLSNCFTTELPWATCGHEWNTENC
VEFQKLNVSNYSHVSLQNATSPVMEFWEHRVLAISDGIEHIGNLRWELALCLLAAWTICY
FCIWKGTKSTGKVVYVTATFPYIMLLILLIRGVTLPGASEGIKFYLYPDLSRLSDPQVWV
DAGTQIFFSYAICLGCLTALGSYNNYNNNCYRDCIMLCCLNSGTSFVAGFAIFSVLGFMA
YEQGVPIAEVAESGPGLAFIAYPKAVTMMPLSPLWATLFFMMLIFLGLDSQFVCVESLVT
AVVDMYPKVFRRGYRRELLILALSVISYFLGLVMLTEGGMYIFQLFDSYAASGMCLLFVA
IFECICIGWVYGSNRFYDNIEDMIGYRPPSLIKWCWMIMTPGICAGIFIFFLIKYKPLKY
NNIYTYPAWGYGIGWLMALSSMLCIPLWICITVWKTEGTLPEKLQKLTTPSTDLKMRGKL
GVSPRMVTVNDCDAKLKSDGTIAAITEKETHF
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgacggcggagaaggcgctgcccctgggcaatgggaaggctgctgaggaggcgcgggag
tccgaggcgccgggtggcggctgcagcagcgggggcgcggcgcccgcgcgccacccgcgc
gtcaagcgcgacaaggcggtccacgagcgcggccactggaacaacaaggtggagttcgtg
ctgagcgtggccggggagatcattgggctgggcaacgtgtggcgcttcccctacctgtgc
tacaagaacggaggaggggcattcctgattccctacgtggtgttttttatttgctgtgga
attcctgtttttttcctggagacagctctggggcagttcacaagtgaaggtggcattacg
tgttggaggaaagtttgccctttatttgaaggcattggctatgcaacacaggtgattgag
gcccatctgaatgtgtactacatcatcatcctggcatgggccattttttacctgagcaac
tgcttcactactgagctaccctgggctacctgtgggcatgagtggaacacagagaattgt
gtggagttccagaaactgaatgtgagcaactacagccatgtgtctctgcagaatgccacc
tcccctgtcatggagttttgggagcaccgggtcctggccatctctgacgggatcgagcac
atcgggaaccttcgctgggagctggccttgtgtctcttggcagcctggaccatctgttac
ttctgtatctggaaggggaccaagtctacaggaaaggttgtatacgtgactgcgacattc
ccctacatcatgctgctgatcctcctgatacgaggggtcacgttgcccggggcctcagag
ggcatcaagttctacttgtaccctgacctctcccggctctccgacccccaggtctgggta
gatgctggaacgcagatctttttctcctatgccatttgcctgggctgtctgaccgctctg
ggaagttataacaattataacaacaactgctacagggactgcatcatgctctgttgcctg
aacagcggcaccagcttcgtggctgggtttgccatcttctcagtcctgggttttatggcg
tacgagcagggggtacccattgctgaggtggcagagtcaggccccggcctggcctttatt
gcgtaccccaaggcggtcaccatgatgcctctctccccgctgtgggccaccttgttcttc
atgatgctcatcttcctgggcctggacagccagtttgtgtgtgtggaaagcctggtgacc
gccgtggtggacatgtaccccaaggttttccggaggggttaccggcgggagctgctcatc
ctagccttgtctgttatctcctattttctgggcctcgtgatgttaacagagggtggcatg
tacatcttccagctctttgactcctatgccgccagtgggatgtgccttctcttcgtggcc
atctttgagtgcatctgcatcggctgggtgtatggaagcaaccggttctatgataacatt
gaagacatgattggctaccggccaccgtcgctcattaagtggtgctggatgatcatgacc
cctgggatctgcgcggggatcttcatcttcttcttgatcaagtacaagccactcaagtac
aacaacatctacacctacccagcctggggctatggcattggctggctcatggccctgtcc
tccatgctctgcatcccgctctggatctgcatcacagtgtggaagacggaggggacactg
cccgagaaactccagaagttgacgacccccagcacagatctgaaaatgcggggcaagctt
ggggtgagcccacggatggtgacagttaatgactgtgatgccaaactcaagagtgacggg
accatcgcagccatcacagagaaggagacgcacttctga

DBGET integrated database retrieval system