KEGG   Homo sapiens (human): 654Help
Entry
654               CDS       T01001                                 

Gene name
BMP6, VGR, VGR1
Definition
(RefSeq) bone morphogenetic protein 6
  KO
K16620  
bone morphogenetic protein 6
Organism
hsa  Homo sapiens (human)
Pathway
TGF-beta signaling pathway
Hippo signaling pathway
Ovarian steroidogenesis
Module
BMP signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    654 (BMP6)
   04390 Hippo signaling pathway
    654 (BMP6)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    654 (BMP6)
Cytokines [BR:hsa04052]
 TGF-beta family
  BMP5 subfamily
   654 (BMP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p24-p23
AA seq 513 aa AA seqDB search
MPGLGRRAQWLCWWWGLLCSCCGPPPLRPPLPAAAAAAAGGQLLGDGGSPGRTEQPPPSP
QSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRPLHGLQQPQPPALRQQEEQQQQQQLP
RGEPPPGRLKSAPLFMLDLYNALSADNDEDGASEGERQQSWPHEAASSSQRRQPPPGAAH
PLNRKSLLAPGSGSGGASPLTSAQDSAFLNDADMVMSFVNLVEYDKEFSPRQRHHKEFKF
NLSQIPEGEVVTAAEFRIYKDCVMGSFKNQTFLISIYQVLQEHQHRDSDLFLLDTRVVWA
SEEGWLEFDITATSNLWVVTPQHNMGLQLSVVTRDGVHVHPRAAGLVGRDGPYDKQPFMV
AFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVS
FQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAP
TKLNAISVLYFDDNSNVILKKYRNMVVRACGCH
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgccggggctggggcggagggcgcagtggctgtgctggtggtgggggctgctgtgcagc
tgctgcgggcccccgccgctgcggccgcccttgcccgctgccgcggccgccgccgccggg
gggcagctgctgggggacggcgggagccccggccgcacggagcagccgccgccgtcgccg
cagtcctcctcgggcttcctgtaccggcggctcaagacgcaggagaagcgggagatgcag
aaggagatcttgtcggtgctggggctcccgcaccggccccggcccctgcacggcctccaa
cagccgcagcccccggcgctccggcagcaggaggagcagcagcagcagcagcagctgcct
cgcggagagccccctcccgggcgactgaagtccgcgcccctcttcatgctggatctgtac
aacgccctgtccgccgacaacgacgaggacggggcgtcggagggggagaggcagcagtcc
tggccccacgaagcagccagctcgtcccagcgtcggcagccgcccccgggcgccgcgcac
ccgctcaaccgcaagagccttctggcccccggatctggcagcggcggcgcgtccccactg
accagcgcgcaggacagcgccttcctcaacgacgcggacatggtcatgagctttgtgaac
ctggtggagtacgacaaggagttctcccctcgtcagcgacaccacaaagagttcaagttc
aacttatcccagattcctgagggtgaggtggtgacggctgcagaattccgcatctacaag
gactgtgttatggggagttttaaaaaccaaacttttcttatcagcatttatcaagtctta
caggagcatcagcacagagactctgacctgtttttgttggacacccgtgtagtatgggcc
tcagaagaaggctggctggaatttgacatcacggccactagcaatctgtgggttgtgact
ccacagcataacatggggcttcagctgagcgtggtgacaagggatggagtccacgtccac
ccccgagccgcaggcctggtgggcagagacggcccttacgacaagcagcccttcatggtg
gctttcttcaaagtgagtgaggtgcacgtgcgcaccaccaggtcagcctccagccggcgc
cgacaacagagtcgtaatcgctctacccagtcccaggacgtggcgcgggtctccagtgct
tcagattacaacagcagtgaattgaaaacagcctgcaggaagcatgagctgtatgtgagt
ttccaagacctgggatggcaggactggatcattgcacccaagggctatgctgccaattac
tgtgatggagaatgctccttcccactcaacgcacacatgaatgcaaccaaccacgcgatt
gtgcagaccttggttcaccttatgaaccccgagtatgtccccaaaccgtgctgtgcgcca
actaagctaaatgccatctcggttctttactttgatgacaactccaatgtcattctgaaa
aaatacaggaatatggttgtaagagcttgtggatgccactaa

DBGET integrated database retrieval system